FAM175A Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• FAM175A Polyclonal antibody, PBS Only (14366-1-PBS)

• 

  WB analysis using 14366-1-AP (same clone as 14366-1-PBS)

  HEK-293T cells were subjected to SDS PAGE followed by western blot with 14366-1-AP (FAM175A antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14366-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 14366-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 14366-1-AP (FAM175A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human testis using 14366-1-AP (same clone as 14366-1-PBS)

  human testis tissue were subjected to SDS PAGE followed by western blot with 14366-1-AP (FAM175A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14366-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Raji using 14366-1-AP (same clone as 14366-1-PBS)

  Raji cells were subjected to SDS PAGE followed by western blot with 14366-1-AP (FAM175A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14366-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 14366-1-AP (same clone as 14366-1-PBS)

  Immunofluorescent analysis of (-20℃ Ethanol) fixed MCF-7 cells using 14366-1-AP (FAM175A antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 14366-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 14366-1-AP (same clone as 14366-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using FAM175A antibody (14366-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 14366-1-PBS in a different storage buffer formulation.

FAM175A Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 14366-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

UNQ496/PRO1013, Coiled-coil domain-containing protein 98, CCDC98, BRCA1-A complex subunit Abraxas 1, ABRAXAS1

---

Product Information

14366-1-PBS targets FAM175A in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5688

  Product name: Recombinant human FAM175A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-300 aa of BC039573

  Sequence: MTFRERLLHKNLQEHFSNQDLVFLLLTPSIITESCSTHRLEHSLYKPQKGLFHRVPLVVANLGMSEQLGYKTVSGSCMSTGFSRAVQTHSSKFFEEDGSLKEVHKINEMYASLQEELKSICKKVEDSEQAVDKLVKDVNRLKREIEKRRGAQIQAAREKNIQKDPQENIFLCQALRTFFPNSEFLHSCVMSLKNRHVSKSSCNYNHHLDVVDNLTLMVEHTDIPEASPASTPQIIKHKALDLDDRWQFKRSRLLDTQDKRSKADTGSSNQDKASKMSSPETDEEIEKMKGFGEYSRSPTF

• Full Name: family with sequence similarity 175, member A
• Calculated Molecular Weight: 47 kDa
• Observed Molecular Weight: 46 kDa
• GenBank Accession Number: BC039573
• Gene Symbol: FAM175A
• Gene ID (NCBI): 84142
• RRID: AB_2262501
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6UWZ7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The family with sequence similarity 175 member A gene (FAM175A; also known as ABRAXAS1, CCDC98 and ABRA1), a member of the DNA repair family, contributes to the BRCA1 (BRCA1 DNA repair associated)-dependent DNA damage response and is associated with age at natural menopause.