FAM190B Polyclonal antibody

• Home
• Products
• Primary Antibodies
• FAM190B Polyclonal antibody (21078-1-AP)

• 

  WB analysis using 21078-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21078-1-AP (FAM190B antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse kidney using 21078-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 21078-1-AP (FAM190B antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 21078-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 21078-1-AP (FAM190B antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

FAM190B Polyclonal Antibody for WB, IHC, ELISA

Cat No. 21078-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

KIAA1128, Gcap14, Protein FAM190B, Protein GCAP14 homolog

---

Tested Applications

• Positive WB detected in: NIH/3T3 cells, U2OS cells
• Positive IHC detected in: mouse kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21078-1-AP targets FAM190B in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15281

  Product name: Recombinant human KIAA1128 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-354 aa of BC030528

  Sequence: MPNGTPVNLLGTSKNSNVKSYIKNNGSDCPSSHSFNWRKANKYQLCAQGVEEPNNTQNSHDKIIDPEKRVPTQGMFDKNGIKGGLKSVSLFTSKLAKPSTMFVSSTEELNQKSFSGPSNLGKFTKGTLLGRTSYSSINTPKSQLNGFYGNRSAGSMQRPRANSCATRSSSGESLAQSPDSSKSINCEKMVRSQSFSHSIQNSFLPPSSITRSHSFNRAVDLTKPYQNQQLSIRVPLRSSMLTRNSRQPEVLNGNEHLGYGFNRPYAAGGKKLALPNGPGVTSTLGYRMVHPSLLKSSRSPFSGTMTVDGNKNSPADTCVEEDATVLAKDRAANKDQELIENESYRTKNNQTMKH

• Full Name: KIAA1128
• Calculated Molecular Weight: 834 aa, 94 kDa
• Observed Molecular Weight: 63 kDa
• GenBank Accession Number: BC030528
• Gene Symbol: KIAA1128
• Gene ID (NCBI): 54462
• RRID: AB_3742014
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H7U1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FAM190B (Family with sequence similarity 190, member B), also known as Gcap14, CCSER2, KIAA1128, NPD012, is a CC domain-containing protein with multiple isoforms generated by alternative splicing that functions as an MAP. FAM190B is a microtubule plus-end-tracking protein and as a regulator of microtubule dynamics during neurodevelopment (PMID: 36795749).