FAM210A Polyclonal antibody

• 

  WB analysis using 31694-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31694-1-AP (FAM210A antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human ovary cancer using 31694-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 31694-1-AP (FAM210A antibody) at dilution of 1:800 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary cancer using 31694-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 31694-1-AP (FAM210A antibody) at dilution of 1:800 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A431 using 31694-1-AP

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using FAM210A antibody (31694-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

FAM210A Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 31694-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

C18orf19

---

Tested Applications

• Positive WB detected in: mouse adipose tissue, mouse heart tissue, rat adipose tissue
• Positive IHC detected in: human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunohistochemistry (IHC): IHC : 1:400-1:1600
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31694-1-AP targets FAM210A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36161

  Product name: Recombinant human C18orf19 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 157-272 aa of NM_001098801

  Sequence: LKGVNVVPFLELIGLPDSVVSILKNSQSGNALTAYALFKIATPARYTVTLGGTSVTVKYLRSHGYMSTPPPVKEYLQDRMEETKELITEKMEETKDRLTEKLQETKEKVSFKKKVE

• Full Name: chromosome 18 open reading frame 19
• Calculated Molecular Weight: 30kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: NM_001098801
• Gene Symbol: C18orf19
• Gene ID (NCBI): 125228
• RRID: AB_3670081
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q96ND0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FAM210A also known as C18orf19, is a determinant of bone and muscle structure and strength. FAM210A is required for cold-induced mitochondrial cristae remodeling, adaptive thermogenic activity, and brown adipose tissue characteristics(PMID: 37816711). FAM210A is localized to mitochondria and cytoplasm of muscle cells and myotubes(PMID: 29618611).