FAM222A Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• FAM222A Polyclonal antibody, PBS Only (31914-1-PBS)

• 

  WB analysis using 31914-1-AP (same clone as 31914-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31914-1-AP (FAM222A antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31914-1-PBS in a different storage buffer formulation.

FAM222A Polyclonal Antibody for WB, Indirect ELISA

Cat No. 31914-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

31914-1-PBS targets FAM222A in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36045

  Product name: Recombinant human C12orf34 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 191-325 aa of BC037221

  Sequence: LPPSNLPSIHSLLYQLNQQCQAPGAAPPACQGMAIPHPSPAKHGPVPSFPSMAYSAAAGLPDCRKGTELGQGATQALTLAGAAKPAGYADSGLDYLLWPQKPPPPPPQPLRAYSGSTVASKSPEACGGRAYERAS

• Full Name: chromosome 12 open reading frame 34
• Calculated Molecular Weight: 47 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC037221
• Gene Symbol: C12orf34
• Gene ID (NCBI): 84915
• RRID: AB_3670141
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q5U5X8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Family with sequence similarity 222 member A (FAM222A, also known as C12orf34) is associated with the progress of Alzheimer's disease (PMID: 31964863; 37092222). It is also a novel key determinant of endothelial biology and angiogenesis (PMID: 37942611).