FAM29A Polyclonal antibody

• Home
• Products
• Primary Antibodies
• FAM29A Polyclonal antibody (16933-1-AP)

FAM29A Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 16933-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

KIAA1574, HAUS6, HAUS augmin-like complex subunit 6, DGT6

• 

  WB analysis of Jurkat using 16933-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 16933-1-AP (FAM29A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 16933-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 16933-1-AP (FAM29A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of K-562 using 16933-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 16933-1-AP (FAM29A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 16933-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using FAM29A antibody (16933-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 16933-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using FAM29A antibody (16933-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for FAM29A in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Jurkat cells, K-562 cells, MCF-7 cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16933-1-AP targets FAM29A in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10421

  Product name: Recombinant human FAM29A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-354 aa of BC010632

  Sequence: MEENRTKEPIQMDVEHREVLPESLPVLHNQREFSMADFLLETTVSDFGQSHLTEEKVISDCECVPQKHVLTSHIDEPPTQNQSDLLNKKVICKQDLECLAFTKLSETSRMETFSPAVGNRIDVMGGSEEEFMKILDHLEVSCNKPSTNKTMLWNSFQISIGISSKSFKDNDFGILHETLPEEVGHLSFNSSSSSEANFKLEPNSPMHGGTLLEDVVGGRQTTPESDFNLQALRSRYEALKKSLSKKREESYLSNSQTPERHKPELSPTPQNVQTDDTLNFLDTCDLHTEHIKPSLRTSIGERKRSLSPLIKFSPVEQRLRTTIACSLGELPNLKEEDILNKSLDAKEPPSDLTR

• Full Name: family with sequence similarity 29, member A
• Calculated Molecular Weight: 955 aa, 109 kDa
• Observed Molecular Weight: 109 kDa
• GenBank Accession Number: BC010632
• Gene Symbol: FAM29A
• Gene ID (NCBI): 54801
• RRID: AB_1939544
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7Z4H7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The FAM29A Polyclonal antibody (Cat# 16933-1-AP) has 2 citations. These appear in Nature Communications (2025), studying endosomal proximity proteomes and Retromer as a hub for RAB GTPase regulation, and Journal of Cell Biology (2022), investigating reconstitution and mechanistic dissection of the human microtubule branching machinery. The associated research fields include endosomal trafficking, RAB GTPase regulation, and microtubule biology.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB,IF	Nat Commun; Mapping of endosomal proximity proteomes reveals Retromer as a hub for RAB GTPase regulation; Authors - Carlos Antón-Plágaro
human	WB	J Cell Biol; Reconstitution and mechanistic dissection of the human microtubule branching machinery.; Authors - Yaqian Zhang