FAM35A Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• FAM35A Polyclonal antibody, PBS Only (26090-1-PBS)

• 

  WB analysis using 26090-1-AP (same clone as 26090-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 26090-1-AP (FAM35A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26090-1-PBS in a different storage buffer formulation.

FAM35A Polyclonal Antibody for WB, Indirect ELISA

Cat No. 26090-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

26090-1-PBS targets FAM35A in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23416

  Product name: Recombinant human FAM35A protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-350 aa of BC051863

  Sequence: MSGGSQVHIFWGAPIAPLKITVSEDTASLMSVADPWKKIQLLYSQHSLYLKDEKQHKNLENYKVPESIGSPDLSGHFLANCMNRHVHVKDDFVRSVSETQNIESQKIHSSRLSDITSSNMQICGFKSTVPHFTEEEKYQKLLSENKIRDEQPKHQPDICGKNFNTNLFQLGHKCAAVLDLVCSTEKINIGPEVVQRECVPTEYHEIQNQCLGLFSSNAVDKSRSEAAVRKVSDLKISTDTEFLSIITSSQVAFLAQKKDKRRSPVNKGNVNMETEPKASYGEIRIPEENSIQLDGFTEAYESGQNQAYSLELFSPVCPKTENSRIHINSDKGLEEHTGSQELFSSEDELP

• Full Name: family with sequence similarity 35, member A
• Observed Molecular Weight: 80-93 kDa
• GenBank Accession Number: BC051863
• Gene Symbol: FAM35A
• Gene ID (NCBI): 54537
• RRID: AB_3085840
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86V20
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.