FAM3C Polyclonal antibody

• Home
• Products
• Primary Antibodies
• FAM3C Polyclonal antibody (14247-1-AP)

FAM3C Polyclonal Antibody for WB, IHC, ELISA

Cat No. 14247-1-AP Copied!

Publications (12)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

GS3786, ILEI, Interleukin like EMT inducer, Interleukin-like EMT inducer, Protein FAM3C

• 

  WB analysis using 14247-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14247-1-AP (FAM3C antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 14247-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 14247-1-AP (FAM3C antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human heart using 14247-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 14247-1-AP (FAM3C antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 14247-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 14247-1-AP (FAM3C antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 14247-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14247-1-AP (FAM3C antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas using 14247-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas using 14247-1-AP (FAM3C antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas using 14247-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas using 14247-1-AP (FAM3C antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 14247-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 14247-1-AP (FAM3C antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 14247-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 14247-1-AP (FAM3C antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 14247-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer using 14247-1-AP (FAM3C antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 14247-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer using 14247-1-AP (FAM3C antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for FAM3C in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HCT 116 cells, human brain tissue, human heart tissue, HEK-293 cells, HT-29 cells, HepG2 cells
• Positive IHC detected in: human pancreas tissue, human stomach cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14247-1-AP targets FAM3C in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5516

  Product name: Recombinant human FAM3C protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 30-227 aa of BC046932

  Sequence: KMDASLGNLFARSALDTAARSTKPPRYKCGISKACPEKHFAFKMASGAANVVGPKICLEDNVLMSGVKNNVGRGINVALANGKTGEVLDTKYFDMWGGDVAPFIEFLKAIQDGTIVLMGTYDDGATKLNDEARRLIADLGSTSITNLGFRDNWVFCGGKGIKTKSPFEQHIKNNKDTNKYEGWPEVVEMEGCIPQKQD

• Full Name: family with sequence similarity 3, member C
• Calculated Molecular Weight: 25 kDa
• Observed Molecular Weight: 25 kDa
• GenBank Accession Number: BC046932
• Gene Symbol: FAM3C
• Gene ID (NCBI): 10447
• RRID: AB_2278149
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92520
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FAM3C, also known as ILEI, is a secreted protein belonging to the cytokine-like protein family. FAM3C is a signaling cytokine with a GG domain, hydrophobic leader sequence and an N-terminal signal peptide. A change in expression of this protein has been noted in pancreatic cancer-derived cells. FAM3C has been involved in the epithelial to mesenchymal transition, and retinal laminar formation processes in vertebrates. Also, FAM3C may play an important role in inner ear development and thus be involved in cell differentiation and proliferation during inner ear embryogenesis.

Publications

What published studies show

FAM3C Polyclonal antibody (Cat# 14247-1-AP) has 12 citations published in journals including Advanced Science, Science Advances, International Journal of Biological Sciences, Journal of Pharmaceutical Analysis, Biochemical Pharmacology, Scientific Reports, Journal of Proteome Research, Diagnostic Pathology, Cancer Medicine, Journal of Clinical Laboratory Analysis, Combinatorial Chemistry & High Throughput Screening, and International Journal of Clinical and Experimental Pathology. Research fields span gastric cancer, pancreatic cancer, glioma, esophageal carcinoma, EMT, metastasis, ER stress, diabetic kidney disease, and pan-cancer analysis.

Automatically generated from the 12 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Adv Sci (Weinh); Hypoxia-Induced circPRELID2 Promotes Gastric Cancer Metastasis by Facilitating ZEB2 Translation via PCBP1 O-GlcNAcylation; Authors - Pengshan Zhang
human	WB	Sci Adv; p53 loss activates prometastatic secretory vesicle biogenesis in the Golgi.; Authors - Xiaochao Tan
mouse,human	WB,IHC	Int J Biol Sci; A Novel ER Stress Mediator TMTC3 Promotes Squamous Cell Carcinoma Progression by Activating GRP78/PERK Signaling Pathway; Authors - Hongyu Yuan
mouse,human	WB,IF	J Pharm Anal; Prioritization of potential drug targets for diabetic kidney disease using integrative omics data mining and causal inference.; Authors - Junyu Zhang ; KD Validated
mouse	WB	Biochem Pharmacol; Restoring mitochondria-endoplasmic reticulum-synapse axis: a proteomic dissection of Rhein's multi-pathway antidepressant mechanism.; Authors - Ziyu Ge
human	IHC	Sci Rep; FAM3 family genes are associated with prognostic value of human cancer: a pan-cancer analysis; Authors - Qing-Tai Dong