FAM3D Polyclonal antibody

• 

  WB analysis of mouse colon using 12336-1-AP

  mouse colon tissue were subjected to SDS PAGE followed by western blot with 12336-1-AP (FAM3D antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat colon using 12336-1-AP

  rat colon tissue were subjected to SDS PAGE followed by western blot with 12336-1-AP (FAM3D antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human stomach cancer using 12336-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 12336-1-AP (FAM3D antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

FAM3D Polyclonal Antibody for WB, IHC, ELISA

Cat No. 12336-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

UNQ567/PRO1130, Protein FAM3D, OIT1, EF7

---

Tested Applications

• Positive WB detected in: mouse colon tissue, rat colon tissue
• Positive IHC detected in: human stomach cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 1 publications below

Product Information

12336-1-AP targets FAM3D in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2965

  Product name: Recombinant human FAM3D protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 24-204 aa of BC015359

  Sequence: RSYMSFSMKTIRLPRWLAASPTKEIQVKKYKCGLIKPCPANYFAFKICSGAANVVGPTMCFEDRMIMSPVKNNVGRGLNIALVNGTTGAVLGQKAFDMYSGDVMHLVKFLKEIPGGALVLVASYDDPGTKMNDESRKLFSDLGSSYAKQLGFRDSWVFIGAKDLRGKSPFEQFLKNSPDTN

• Full Name: family with sequence similarity 3, member D
• Calculated Molecular Weight: 224 aa, 24 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC015359
• Gene Symbol: FAM3D
• Gene ID (NCBI): 131177
• RRID: AB_10667402
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96BQ1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FAM3 (family with sequence similarity 3) is a cytokine-like family consisting of four members, FAM3A, FAM3B, FAM3C, and FAM3D, who share a 4-helical bundle structure. FAM3D is constitutively expressed in the gastrointestinal tract and is regulated by nutritional status. FAM3D controls blood sugar levels by acting as an insulin-sensitizing protein and improves lipid deposition in the liver. (PMID: 22226334; PMID: 37328068)

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Aging (Albany NY); DNA methylation-driven gene FAM3D promotes colorectal cancer growth via the ATF4-SESN2-mTORC1 pathway; Authors - Ting Zheng ; KO Validated