FAM3D Polyclonal antibody

• 

  WB analysis using 32785-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32785-1-AP (FAM3D antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse colon using 32785-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 32785-1-AP (FAM3D antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse colon using 32785-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 32785-1-AP (FAM3D antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

FAM3D Polyclonal Antibody for WB, IHC, ELISA

Cat No. 32785-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, IHC, ELISA

Synonyms

Oit1, Oncoprotein-induced protein 1, Protein EF-7, Protein FAM3D

---

Tested Applications

• Positive WB detected in: mouse colon tissue, rat colon tissue
• Positive IHC detected in: mouse colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunohistochemistry (IHC): IHC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32785-1-AP targets FAM3D in WB, IHC, ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg2694

  Product name: Recombinant Mouse Oit1 protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 26-223 aa of NM_146050.2

  Sequence: YTSFSRKTIRLPRWLGITPKDIQTPKSKCGLSKICPNNFFAFKISSGAANVVGPSMCFEDEIIMSPVRNNVGRGLNVALVNGSTGQVMKKDSFDMYSGDPQLLLNFLTEIPDSTLVLVASYDDPGTKMNDKIKTLFSNLGSSYAKQLGFRDSWVFVGAKDLKSKSPYEQFLKNNPETNKYDGWPELLELEGCVPRKVM

• Full Name: oncoprotein induced transcript 1
• Calculated Molecular Weight: 25 kDa
• Observed Molecular Weight: 25 kDa
• GenBank Accession Number: NM_146050.2
• Gene Symbol: Oit1
• Gene ID (NCBI): 18300
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P97805
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FAM3D (family with sequence similarity 3, member D) is a protein that belongs to the FAM3 family, which is a novel cytokine-like gene family identified in 2002. This family comprises four members: FAM3A, FAM3B, FAM3C, and FAM3D. FAM3D is a gut-secreted protein that is regulated by nutritional status. It has a predicted secondary structure of a four-helix bundle, which is a common feature in many other cytokines.