Mouse FAM3D Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86090-2-RR (same clone as 86090-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86090-2-RR (FAM3D antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86090-2-PBS in a different storage buffer formulation.

• 

  WB analysis using 86090-2-RR (same clone as 86090-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86090-2-RR (FAM3D antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86090-2-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse colon using 86090-2-RR (same clone as 86090-2-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 86090-2-RR (FAM3D antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86090-2-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse colon using 86090-2-RR (same clone as 86090-2-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 86090-2-RR (FAM3D antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86090-2-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse colon using 86090-2-RR (same clone as 86090-2-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 86090-2-RR (FAM3D antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86090-2-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse colon using 86090-2-RR (same clone as 86090-2-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 86090-2-RR (FAM3D antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86090-2-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse colon using 86090-2-RR (same clone as 86090-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse colon tissue using FAM3D antibody (86090-2-RR, Clone: 250561E10 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86090-2-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse colon using 86090-2-RR (same clone as 86090-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse colon tissue using FAM3D antibody (86090-2-RR, Clone: 250561E10 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86090-2-PBS in a different storage buffer formulation.

FAM3D Uni-rAb^® Recombinant Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 86090-2-PBS

Clone No.250561E10

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

Oit1, Oncoprotein-induced protein 1, Protein EF-7, Protein FAM3D

---

Product Information

86090-2-PBS targets FAM3D in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2694

  Product name: Recombinant Mouse Oit1 protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 26-223 aa of NM_146050.2

  Sequence: YTSFSRKTIRLPRWLGITPKDIQTPKSKCGLSKICPNNFFAFKISSGAANVVGPSMCFEDEIIMSPVRNNVGRGLNVALVNGSTGQVMKKDSFDMYSGDPQLLLNFLTEIPDSTLVLVASYDDPGTKMNDKIKTLFSNLGSSYAKQLGFRDSWVFVGAKDLKSKSPYEQFLKNNPETNKYDGWPELLELEGCVPRKVM

• Full Name: oncoprotein induced transcript 1
• Calculated Molecular Weight: 25 kDa
• Observed Molecular Weight: 25 kDa
• GenBank Accession Number: NM_146050.2
• Gene Symbol: Oit1
• Gene ID (NCBI): 18300
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P97805
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.