FAM40A Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• FAM40A Polyclonal antibody, PBS Only (32554-1-PBS)

• 

  WB analysis using 32554-1-AP (same clone as 32554-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32554-1-AP (FAM40A antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32554-1-PBS in a different storage buffer formulation.

FAM40A Polyclonal Antibody for WB, Indirect ELISA

Cat No. 32554-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, Indirect ELISA

Synonyms

KIAA1761, Protein FAM40A, Striatin-interacting protein 1, STRIP1

---

Product Information

32554-1-PBS targets FAM40A in WB, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38142

  Product name: Recombinant human FAM40A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 335-420 aa of BC121793

  Sequence: SPPASASDLIEQQQKRGRREHKALIKQDNLDAFNERDPYKADDSREEEEENDDDNSLEGETFPLERDEVMPPPLQHPQTDRLTCPK

• Full Name: family with sequence similarity 40, member A
• Calculated Molecular Weight: 837 aa, 96 kDa
• Observed Molecular Weight: 95-110 kDa
• GenBank Accession Number: BC121793
• Gene Symbol: FAM40A
• Gene ID (NCBI): 85369
• RRID: AB_3742655
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q5VSL9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

FAM40A plays a role in the regulation of cell morphology and cytoskeletal organization. It is required in the cortical actin filament dynamics and cell shape.