• Featured Product
  • KD/KO Validated

FAM40B Polyclonal antibody

FAM40B Polyclonal Antibody for WB, ELISA
Cat No. 25163-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

STRIP2, Striatin-interacting protein 2, Protein FAM40B, KIAA1170

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse testis tissue, rat testis tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

25163-1-AP targets FAM40B in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag18230

Product name: Recombinant human FAM40B protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 268-413 aa of BC019064

Sequence: KVLLLLWKVVMFTLGGFEHLQTLKVQKRAELGLPPLAEDSIQVVKSMRAASPPSYTLDLGESQLAPPPSKLRGRRGSRRQLLTKQDSLDIYNERDLFKTEEPATEEEEESAGDGERTLDGELDLLEQDPLVPPPPSQAPLSAERVA

Predict reactive species
Full Name family with sequence similarity 40, member B
Calculated Molecular Weight 834 aa, 95 kDa
Observed Molecular Weight 95-100 kDa
GenBank Accession NumberBC019064
Gene Symbol FAM40B
Gene ID (NCBI) 57464
RRIDAB_2879933
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9ULQ0
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FAM40B, also known as STRIP2, is a member of the striatin-interacting phosphatase and kinase (STRIPAK) complex that is involved in the regulation of various processes such as cell proliferation and differentiation. Fam40b in ESCs is as a perinuclear and nucleolar protein with a molecular weight of 96kDa (PMID: 25010986). The expression of Fam40b is essential for the lineage commitment of murine embryonic stem cells (mESCs) into differentiated somatic cells via mechanisms involving pluripotency and epigenetic networks. Catalog#17293-1-AP specially recognises the 96 kDa protein.

Protocols

Product Specific Protocols
WB protocol for FAM40B antibody 25163-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
ratWB

J Biol Chem

Mst4, a novel cardiac STRIPAK complex-associated kinase, regulates cardiomyocyte growth and survival and is upregulated in human cardiomyopathy

Authors - Matthias Eden
humanWB,IP,IHC,IF

Genomics

STRIP2 is regulated by the transcription factor Sp1 and promotes lung adenocarcinoma progression via activating the PI3K/AKT/mTOR/MYC signaling pathway

Authors - Junfan Pan
  • KO Validated
humanWB,IF

J Cell Physiol

STRIP2 silencing inhibits vascular smooth muscle cell proliferation and migration via P38-AKT-MMP-2 signaling pathway.

Authors - Li Dai
  • KD Validated
Loading...
||
New chat Able
正在加载,请稍候...