FAM40B Polyclonal antibody

• 

  WB analysis using 25163-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25163-1-AP (FAM40B antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• Featured Product
• KD/KO Validated

FAM40B Polyclonal Antibody for WB, ELISA

Cat No. 25163-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Synonyms

STRIP2, Striatin-interacting protein 2, Protein FAM40B, KIAA1170

---

Tested Applications

• Positive WB detected in: mouse testis tissue, rat testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 3 publications below
• IHC: See 1 publications below
• IF: See 2 publications below
• IP: See 1 publications below

Product Information

25163-1-AP targets FAM40B in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18230

  Product name: Recombinant human FAM40B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 268-413 aa of BC019064

  Sequence: KVLLLLWKVVMFTLGGFEHLQTLKVQKRAELGLPPLAEDSIQVVKSMRAASPPSYTLDLGESQLAPPPSKLRGRRGSRRQLLTKQDSLDIYNERDLFKTEEPATEEEEESAGDGERTLDGELDLLEQDPLVPPPPSQAPLSAERVA

• Full Name: family with sequence similarity 40, member B
• Calculated Molecular Weight: 834 aa, 95 kDa
• Observed Molecular Weight: 95-100 kDa
• GenBank Accession Number: BC019064
• Gene Symbol: FAM40B
• Gene ID (NCBI): 57464
• RRID: AB_2879933
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9ULQ0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FAM40B, also known as STRIP2, is a member of the striatin-interacting phosphatase and kinase (STRIPAK) complex that is involved in the regulation of various processes such as cell proliferation and differentiation. Fam40b in ESCs is as a perinuclear and nucleolar protein with a molecular weight of 96kDa (PMID: 25010986). The expression of Fam40b is essential for the lineage commitment of murine embryonic stem cells (mESCs) into differentiated somatic cells via mechanisms involving pluripotency and epigenetic networks. Catalog#17293-1-AP specially recognises the 96 kDa protein.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	J Biol Chem; Mst4, a novel cardiac STRIPAK complex-associated kinase, regulates cardiomyocyte growth and survival and is upregulated in human cardiomyopathy; Authors - Matthias Eden
human	WB,IP,IHC,IF	Genomics; STRIP2 is regulated by the transcription factor Sp1 and promotes lung adenocarcinoma progression via activating the PI3K/AKT/mTOR/MYC signaling pathway; Authors - Junfan Pan ; KO Validated
human	WB,IF	J Cell Physiol; STRIP2 silencing inhibits vascular smooth muscle cell proliferation and migration via P38-AKT-MMP-2 signaling pathway.; Authors - Li Dai ; KD Validated