FAM46C Polyclonal antibody

• Home
• Products
• Primary Antibodies
• FAM46C Polyclonal antibody (25038-1-AP)

• Featured Product
• KD/KO Validated

FAM46C Polyclonal Antibody for IHC, ELISA

Cat No. 25038-1-AP Copied!

Publications (4)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

EC:2.7.7.19, Non-canonical poly(A) polymerase FAM46C, TENT5C, Terminal nucleotidyltransferase 5C

• 

  IHC staining of mouse spleen using 25038-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 25038-1-AP (FAM46C antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 25038-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 25038-1-AP (FAM46C antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 25038-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 25038-1-AP (FAM46C antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human spleen using 25038-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 25038-1-AP (FAM46C antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse kidney using 25038-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 25038-1-AP (FAM46C antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat heart using 25038-1-AP

  Immunohistochemical analysis of paraffin-embedded rat heart tissue slide using 25038-1-AP (FAM46C antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat kidney using 25038-1-AP

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 25038-1-AP (FAM46C antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat spleen using 25038-1-AP

  Immunohistochemical analysis of paraffin-embedded rat spleen tissue slide using 25038-1-AP (FAM46C antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for FAM46C in ?

Chat with Able

---

Tested Applications

• Positive IHC detected in: human prostate cancer tissue, rat spleen tissue, mouse spleen tissue, mouse kidney tissue, human spleen tissue, rat kidney tissue, rat heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25038-1-AP targets FAM46C in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19147

  Product name: Recombinant human FAM46C protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-67 aa of BC131726

  Sequence: MAEESSCTRDCMSFSVLNWDQVSRLHEVLTEVVPIHGRGNFPTLEITLKDIVQTVRSRLEEAGIKVH

• Full Name: family with sequence similarity 46, member C
• Calculated Molecular Weight: 391 aa, 45 kDa
• GenBank Accession Number: BC131726
• Gene Symbol: FAM46C
• Gene ID (NCBI): 54855
• RRID: AB_2879863
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5VWP2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The FAM46C Polyclonal antibody (Cat# 25038-1-AP) has a total of 4 citations. These appear in Cancer Research (2 papers), Cell Reports (1 paper), and Cancer Science (1 paper). The associated research fields include osteosarcoma stemness maintenance, myeloma cell survival, ER-associated mRNA polyadenylation via TENT5 proteins, and Akt signaling activation in multiple myeloma tumor growth.

Automatically generated from the 4 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cancer Res; Loss of FAM46C promotes cell survival in myeloma.; Authors - Yuan Xiao Zhu
human	WB	Cancer Res; TENT5A Maintains MYC mRNA Stability to Enhance Osteosarcoma Stemness.; Authors - Yining Tao
human	WB	Cell Rep; The C-terminal region of TENT5 proteins drives ER-associated mRNA polyadenylation via FNDC3 interaction.; Authors - Lisa Viviani
human	WB	Cancer Sci; Biallelic loss of FAM46C triggers tumor growth with concomitant activation of Akt signaling in multiple myeloma cells.; Authors - Jo Kanasugi ; KO Validated