Published Applications
| KD/KO | See 1 publications below |
| WB | See 3 publications below |
Product Information
25038-1-AP targets FAM46C in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag19147 Product name: Recombinant human FAM46C protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-67 aa of BC131726 Sequence: MAEESSCTRDCMSFSVLNWDQVSRLHEVLTEVVPIHGRGNFPTLEITLKDIVQTVRSRLEEAGIKVH Predict reactive species |
| Full Name | family with sequence similarity 46, member C |
| Calculated Molecular Weight | 391 aa, 45 kDa |
| GenBank Accession Number | BC131726 |
| Gene Symbol | FAM46C |
| Gene ID (NCBI) | 54855 |
| RRID | AB_2879863 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q5VWP2 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Publications
| Species | Application | Title |
|---|---|---|
Cancer Sci Biallelic loss of FAM46C triggers tumor growth with concomitant activation of Akt signaling in multiple myeloma cells.
| ||
Cell Rep The C-terminal region of TENT5 proteins drives ER-associated mRNA polyadenylation via FNDC3 interaction. |













