Tested Applications
| Positive WB detected in | mouse testis tissue, rat testis tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
24467-1-AP targets FAM47B in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag21562 Product name: Recombinant human FAM47B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 308-412 aa of BC035026 Sequence: RPEPSKTQVSSLCPEPPEAGVSHLCLEPPNTHRVSSFLLQVLKLDSEKKLEDARARCEGQEMTTEELTKPGKYHFWESCPRPFESRMPHLRLVLPITRRMASLCL Predict reactive species |
| Full Name | family with sequence similarity 47, member B |
| Calculated Molecular Weight | 645 aa, 74 kDa |
| Observed Molecular Weight | 70 kDa |
| GenBank Accession Number | BC035026 |
| Gene Symbol | FAM47B |
| Gene ID (NCBI) | 170062 |
| RRID | AB_3669438 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8NA70 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
FAM47B(Family with sequence similarity 47 member B) belongs to the FAM47 family and is expressed in testis.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for FAM47B antibody 24467-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

