FAM48A Polyclonal antibody

• 

  WB analysis of PC-3 using 24419-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 24419-1-AP (FAM48A Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of PC-3 using 24419-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 24419-1-AP (FAM48A Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 24419-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 24419-1-AP (FAM48A Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse testis using 24419-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 24419-1-AP (FAM48A antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 24419-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 24419-1-AP (FAM48A antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human testis using 24419-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 24419-1-AP (FAM48A Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human testis using 24419-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 24419-1-AP (FAM48A Antibody) at dilution of 1:50 (under 40x lens).

FAM48A Polyclonal Antibody for WB, IHC, ELISA

Cat No. 24419-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

C13, C13orf19, FAM48A, FP757, p38 interacting protein, P38IP, Protein FAM48A

---

Tested Applications

• Positive WB detected in: PC-3 cells, Jurkat cells
• Positive IHC detected in: mouse testis tissue, human testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24419-1-AP targets FAM48A in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19875

  Product name: Recombinant human FAM48A protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 482-701 aa of BC030686

  Sequence: TPQQTSSFLKSPTPPPSSKPSSIPRKSSVDLNQVSMLSPAALSPASSSQRTTATQVMANSAGLNFINVVGSVCGAQALMSGSNPMLGCNTGAITPAGINLSGLLPSGGLLPNALPSAMQAASQAGVPFGLKNTSSLRPLNLLQLPGGSLIFNTLQQQQQQLSQFTPQQPQQPTTCSPQQPGEQGSEQGSTSQEQALSAQQAAVINLTGVGSFMQSQAAVL

• Full Name: family with sequence similarity 48, member A
• Calculated Molecular Weight: 779 aa, 86 kDa
• Observed Molecular Weight: 86 kDa
• GenBank Accession Number: BC030686
• Gene Symbol: FAM48A
• Gene ID (NCBI): 55578
• RRID: AB_2879537
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NEM7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FAM48A also named as C13orf19 or SUPT20H is a 779 amino acid protein, which belongs to the SPT20 family. FAM48A is required for MAP kinase p38 activation during gastrulation and for starvation-induced ATG9A trafficking during autophagy. FAM48A localizes in the nucleus and is highly expressed in testis, moderately in brain and pituitary gland.