FAM50B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• FAM50B Polyclonal antibody, PBS Only (32562-1-PBS)

• 

  WB analysis using 32562-1-AP (same clone as 32562-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32562-1-AP (FAM50B antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32562-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 32562-1-AP (same clone as 32562-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32562-1-AP (FAM50B antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32562-1-PBS in a different storage buffer formulation.

FAM50B Polyclonal Antibody for WB, Indirect ELISA

Cat No. 32562-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Protein FAM50B, Protein XAP-5-like, X5L

---

Product Information

32562-1-PBS targets FAM50B in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38226

  Product name: Recombinant human FAM50B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 73-141 aa of NM_012135.2

  Sequence: MKARQEALVRERERQLAKRQHLEEQRLQQERQREQEQRRERKRKISCLSFALDDLDDQADAAEARRAGN

• Full Name: family with sequence similarity 50, member B
• Calculated Molecular Weight: 39kDa，325aa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: NM_012135.2
• Gene Symbol: FAM50B
• Gene ID (NCBI): 26240
• RRID: AB_3742656
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9Y247
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

FAM50B, also known as family with sequence similarity 50, member B, is a protein-coding gene located on chromosome 6. It is widely expressed in various tissues, with particularly high abundance in the testis and both adult and fetal brain. The exact function of FAM50B is not yet fully understood and is still under investigation.