FAM57B Polyclonal antibody

• 

  WB analysis using 20760-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 20760-1-AP (FAM57B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse colon using 20760-1-AP

  mouse colon tissue were subjected to SDS PAGE followed by western blot with 20760-1-AP (FAM57B antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 20760-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 20760-1-AP (FAM57B antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 20760-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 20760-1-AP (FAM57B antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 20760-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 20760-1-AP (FAM57B antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 20760-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 20760-1-AP (FAM57B antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

FAM57B Polyclonal Antibody for WB, IHC, ELISA

Cat No. 20760-1-AP

Publications(1)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

FAM57B, FP1188, Protein FAM57B

---

Tested Applications

• Positive WB detected in: mouse brain tissue, mouse colon tissue, HeLa cells, rat brain tissue
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 1 publications below

Product Information

20760-1-AP targets FAM57B in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14707

  Product name: Recombinant human FAM57B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 46-140 aa of BC007892

  Sequence: SVQAIMASTAGYIVSTSCKHIIDDQHWLSSAYTQFAVPYFIYDIYAMFLCHWHKHQVKGHGGDDGAARAPGSTWAIARGYLHKEFLMVLHHAAMV

• Full Name: family with sequence similarity 57, member B
• Calculated Molecular Weight: 274 aa, 31 kDa
• Observed Molecular Weight: 31 kDa
• GenBank Accession Number: BC007892
• Gene Symbol: FAM57B
• Gene ID (NCBI): 83723
• RRID: AB_10732598
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q71RH2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	iScience; 16pdel lipid changes in iPSC-derived neurons and function of FAM57B in lipid metabolism and synaptogenesis; Authors - Danielle L ; KO Validated

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Danielle (Verified Customer) (12-16-2018)

This is the only antibody I've found that resolves FAM57B at the correct size. However, the antibody is not very clean with the SH-SY5Y cells and will show multiple bands.

• Applications: Western Blot,
• Primary Antibody Dilution: 1:250
• Cell Tissue Type: SH-SY5Y