ESYT2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ESYT2 Polyclonal antibody (24385-1-AP)

• Featured Product
• KD/KO Validated

ESYT2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 24385-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

FAM62B, Extended synaptotagmin-2, Extended synaptotagmin 2, E-Syt2, E Syt2

• 

  WB analysis using 24385-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24385-1-AP (FAM62B antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 24385-1-AP

  WB result of FAM62B antibody (24385-1-AP; 1:8000; incubated at room temperature for 1.5 hours) with sh-Control and sh-FAM62B transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human intrahepatic cholangiocarcinoma using 24385-1-AP

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 24385-1-AP (ESYT2 antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human intrahepatic cholangiocarcinoma using 24385-1-AP

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 24385-1-AP (ESYT2 antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ESYT2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: K-562 cells, HeLa cells, LNCaP cells
• Positive IHC detected in: human intrahepatic cholangiocarcinoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24385-1-AP targets ESYT2 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20420

  Product name: Recombinant human FAM62B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 559-773 aa of BC013957

  Sequence: NPVVQMSVGHKAQESKIRYKTNEPVWEENFTFFIHNPKRQDLEVEVRDEQHQCSLGNLKVPLSQLLTSEDMTVSQRFQLSNSGPNSTIKMKIALRVLHLEKRERPPDHQHSAQVKRPSVSKEGRKTSIKSHMSGSPGPGGSNTAPSTPVIGGSDKPGMEEKAQPPEAGPQGLHDLGRSSSSLLASPGHISVKEPTPSIASDISLPIATQELRQRL

• Full Name: family with sequence similarity 62 (C2 domain containing) member B
• Calculated Molecular Weight: 921 aa, 102 kDa
• Observed Molecular Weight: 90-100 kDa
• GenBank Accession Number: BC013957
• Gene Symbol: ESYT2
• Gene ID (NCBI): 57488
• RRID: AB_2879519
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: A0FGR8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ESYT2, also named FAM62B, one of the three-member family of Extended Synaptotagmins that were recently shown to be implicated in the formation of endoplasmic reticulum (ER)-plasma membrane (PM) junctions and in the Ca(2+) dependent regulation of these junctions.

Publications

What published studies show

The ESYT2 (FAM62B) polyclonal antibody, catalog number 24385-1-AP, has a total of 1 citation. The citation appears in Frontiers in Cell and Developmental Biology (2022), where the antibody was used in Western blot to study the interaction between the resealing factor S100A11, annexins, and extended synaptotagmin-1 during plasma membrane wound repair. The research field is cell biology, specifically membrane repair mechanisms.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Front Cell Dev Biol; The resealing factor S100A11 interacts with annexins and extended synaptotagmin-1 in the course of plasma membrane wound repair; Authors - Arsila P. K. Ashraf ; KD Validated