ESYT2 Polyclonal antibody

• 

  WB analysis using 24385-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24385-1-AP (FAM62B antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 24385-1-AP

  WB result of FAM62B antibody (24385-1-AP; 1:8000; incubated at room temperature for 1.5 hours) with sh-Control and sh-FAM62B transfected HeLa cells.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 24385-1-AP

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 24385-1-AP (ESYT2 antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 24385-1-AP

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 24385-1-AP (ESYT2 antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

ESYT2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 24385-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

FAM62B, Extended synaptotagmin-2, Extended synaptotagmin 2, E-Syt2, E Syt2

---

Tested Applications

• Positive WB detected in: K-562 cells, HeLa cells, LNCaP cells
• Positive IHC detected in: human intrahepatic cholangiocarcinoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 1 publications below

Product Information

24385-1-AP targets ESYT2 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20420

  Product name: Recombinant human FAM62B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 559-773 aa of BC013957

  Sequence: NPVVQMSVGHKAQESKIRYKTNEPVWEENFTFFIHNPKRQDLEVEVRDEQHQCSLGNLKVPLSQLLTSEDMTVSQRFQLSNSGPNSTIKMKIALRVLHLEKRERPPDHQHSAQVKRPSVSKEGRKTSIKSHMSGSPGPGGSNTAPSTPVIGGSDKPGMEEKAQPPEAGPQGLHDLGRSSSSLLASPGHISVKEPTPSIASDISLPIATQELRQRL

• Full Name: family with sequence similarity 62 (C2 domain containing) member B
• Calculated Molecular Weight: 921 aa, 102 kDa
• Observed Molecular Weight: 90-100 kDa
• GenBank Accession Number: BC013957
• Gene Symbol: ESYT2
• Gene ID (NCBI): 57488
• RRID: AB_2879519
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: A0FGR8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ESYT2, also named FAM62B, one of the three-member family of Extended Synaptotagmins that were recently shown to be implicated in the formation of endoplasmic reticulum (ER)-plasma membrane (PM) junctions and in the Ca(2+) dependent regulation of these junctions.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Front Cell Dev Biol; The resealing factor S100A11 interacts with annexins and extended synaptotagmin-1 in the course of plasma membrane wound repair; Authors - Arsila P. K. Ashraf ; KD Validated