FAM72 Polyclonal antibody

• 

  WB analysis using 21203-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21203-1-AP (FAM72 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 21203-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 21203-1-AP (FAM72 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse spleen using 21203-1-AP

  mouse spleen tissue were subjected to SDS PAGE followed by western blot with 21203-1-AP (FAM72A antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon cancer using 21203-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 21203-1-AP (FAM72 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 21203-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 21203-1-AP (FAM72 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

FAM72 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 21203-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

FAM72A, UGENE, Protein FAM72A, LMPIP, LMP1-induced protein

---

Tested Applications

• Positive WB detected in: HT-29 cells, mouse spleen tissue, HeLa cells, Raji cells
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 2 publications below
• IHC: See 1 publications below

Product Information

21203-1-AP targets FAM72 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15566

  Product name: Recombinant human FAM72A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-149 aa of BC035696

  Sequence: MSTNICSFKDRCVSILCCKFCKQVLSSRGMKAVLLADTEIDLFSTDIPPTNAVDFTGRCYFTKICKCKLKDIACLKCGNIVGYHVIVPCSSCLLSCNNGHFWMFHSQAVYDINRLDSTGVNVLLWGNLPEIEESTDEDVLNISAEECIR

• Full Name: family with sequence similarity 72, member A
• Calculated Molecular Weight: 149 aa, 17 kDa
• Observed Molecular Weight: 15-20 kDa
• GenBank Accession Number: BC035696
• Gene Symbol: FAM72
• Gene ID (NCBI): 729533
• RRID: AB_10733346
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5TYM5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FAM72A, also named as LMIP and UGENE, is a mitochondrial protein which regulates cellular reactive oxygen species metabolism. It's up-regulated in malignant colon cancers, compared to normal colon and colon adenomas. FAM72 has some members A/B/C/D with higher homology. This antibody detects all the members of FAM72.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse	IHC,WB	Front Oncol; Integrated systemic analysis of FAM72A to identify its clinical relevance, biological function, and relationship to drug sensitivity in hepatocellular carcinoma; Authors - Qi Zhou ; KD Validated
human	WB	Int J Mol Sci; Prognostic and Immunological Implications of FAM72A in Pan-Cancer and Functional Validations; Authors - Yuwen Bai ; KD Validated