MIGA2/FAM73B Polyclonal antibody

• 

  WB analysis using 29811-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29811-1-AP (FAM73B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

MIGA2/FAM73B Polyclonal Antibody for WB, ELISA

Cat No. 29811-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

MIGA2, FAM73B, PSEC0112, Protein FAM73B, Mitoguardin 2

---

Tested Applications

• Positive WB detected in: A431 cells, HeLa cells, U2O2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

29811-1-AP targets MIGA2/FAM73B in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30577

  Product name: Recombinant human FAM73B protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 62-180 aa of BC009114

  Sequence: AHQLKRRRRRKKQVGPEMGGEQLGTVPLPILLARKVPSVKKGYSSRRVQSPSSKSNDTLSGISSIEPSKHSGSSHSVASMMAVNSSSPTAACSGLWDARGMEESLTTSDGNAESLYMQG

• Full Name: family with sequence similarity 73, member B
• Observed Molecular Weight: 65-70 kDa
• GenBank Accession Number: BC009114
• Gene Symbol: MIGA2/FAM73B
• Gene ID (NCBI): 84895
• RRID: AB_3086170
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7L4E1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MIGA2 (mitoguardin-2) also named as FAM73B, is a mitochondrial protein at contacts with the ER and/or lipid droplets (LDs), and identified as a lipid transporter. MIGA2 localizes to contact sites between mitochondria and the ER or mitochondria and lipid droplets (LDs) (PMID: 36282247). Based on its presence in many tissues, MIGA2 is likely critical for lipid and energy homeostasis in a wide spectrum of cell types (PMID: 31628041).