Filter: AllWBIHC

WB analysis using 32882-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 32882-1-AP (FAM76B antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.
IHC staining of mouse brain using 32882-1-AP
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 32882-1-AP (FAM76B antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of mouse brain using 32882-1-AP
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 32882-1-AP (FAM76B antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

FAM76B Polyclonal antibody

FAM76B Polyclonal Antibody for WB, ELISA

Cat No. 32882-1-AP

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

Protein FAM76B

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in

J774A.1 cells, SH-SY5Y cells, SK-N-SH cells, U-937 cells, RAW 264.7 cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:1000-1:8000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

32882-1-AP targets FAM76B in WB, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag36658 Product name: Recombinant human FAM76B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 179-277 aa of NM_144664.4 Sequence: HHRHSSSHHKISNLSPEEEQGLWKQSHKSSATIQNETPKKKPKLESKPSNGDSSSINQSADSGGTDNFVLISQLKEEVMSLKRLLQQRDQTILEKDKKL Predict reactive species
Full Name	family with sequence similarity 76, member B
Calculated Molecular Weight	39kDa，339aa
Observed Molecular Weight	36-39 kDa
GenBank Accession Number	NM_144664.4
Gene Symbol	FAM76B
Gene ID (NCBI)	143684
RRID	AB_3742775
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity Purification
UNIPROT ID	Q5HYJ3
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FAM76B is a nuclear protein with a molecular weight of about 39 kDa. Its amino acid sequence is highly conserved, and it is highly similar to FAM76B sequence of rats, mice and zebrafish. The protein contains histidine repeat sequence (poly-His domain) and ubiquitination site of Lys-225. FAM76B inhibits the inflammatory reaction mediated by NF-κB by affecting the cytoplasmic translocation of hnRNPA2B1. The expression of inflammatory factors (such as IL-6) increased significantly in FAM76B gene knockout mice, indicating that FAM76B has anti-inflammatory effect.