FAM82A1 Polyclonal antibody

• 

  WB analysis using 33752-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33752-1-AP (FAM82A1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 33752-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33752-1-AP (FAM82A1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of U2OS using 33752-1-AP

  IP result of anti-FAM82A1 (IP:33752-1-AP, 4ug; Detection:33752-1-AP 1:2000) with U2OS cells lysate 760 ug.

• 

  IHC staining of human urothelial carcinoma using 33752-1-AP

  Immunohistochemical analysis of paraffin-embedded human urothelial carcinoma tissue slide using 33752-1-AP (FAM82A1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human urothelial carcinoma using 33752-1-AP

  Immunohistochemical analysis of paraffin-embedded human urothelial carcinoma tissue slide using 33752-1-AP (FAM82A1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of SH-SY5Y using 33752-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed SH-SY5Y cells using FAM82A1 antibody (33752-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  IF Staining of U2OS using 33752-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed U2OS cells using FAM82A1 antibody (33752-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

FAM82A1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 33752-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

BLOCK18, FAM82A, hRMD-2, Protein FAM82A1, Regulator of microtubule dynamics protein 2

---

Tested Applications

• Positive WB detected in: HeLa cells, mouse liver tissue, U2OS cells, human testis tissue, rat liver
• Positive IP detected in: U2OS cells
• Positive IHC detected in: human urothelial carcinoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: U2OS cells, SH-SY5Y cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33752-1-AP targets FAM82A1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag40522

  Product name: Recombinant human FAM82A1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 29-125 aa of BC024243

  Sequence: KVRKPGIAMKLPEFLSLGNTFNSITLQDEIHDDQGTTVIFQERQLQILEKLNELLTNMEELKEEIRFLKEAIPKLEEYIQDELGGKITVHKISPQHR

• Full Name: family with sequence similarity 82, member A1
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC024243
• Gene Symbol: FAM82A1
• Gene ID (NCBI): 151393
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q96LZ7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FAM82A1 is a crucial cellular signaling regulatory protein that has recently gained attention for its role in tumorigenesis. Research indicates that it serves as an important regulatory subunit of protein phosphatase 2A (PP2A), participating in the precise regulation of cell cycle progression and apoptosis by influencing key signaling pathways such as JNK/c-Jun. In various cancers (e.g., glioblastoma, lung cancer), FAM82A1 often exhibits abnormally high expression, which is closely associated with accelerated cancer cell proliferation, inhibited apoptosis, and poor patient prognosis. Its cancer-promoting function is primarily achieved by sustaining cancer cell survival, making FAM82A1 not only a potential tumor biomarker but also a promising new target for anti-cancer therapy worthy of further exploration.