FAM82B Polyclonal antibody

• Home
• Products
• Primary Antibodies
• FAM82B Polyclonal antibody (24919-1-AP)

• 

  WB analysis using 24919-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24919-1-AP (FAM82B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 24919-1-AP

  IP result of anti-FAM82B (IP:24919-1-AP, 4ug; Detection:24919-1-AP 1:600) with HeLa cells lysate 1760 ug.

FAM82B Polyclonal Antibody for WB, IP, ELISA

Cat No. 24919-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, ELISA

Synonyms

CGI 90, hRMD 1, Protein FAM82B, RMD 1, RMD1

---

Tested Applications

• Positive WB detected in: mouse heart tissue, rat heart tissue
• Positive IP detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24919-1-AP targets FAM82B in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20679

  Product name: Recombinant human FAM82B protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-314 aa of BC009671

  Sequence: MALAARLWRLLPFRRGAAPGSRLPAGTSGSRGHCGPCRFRGFEVMGNPGTFKRGLLLSALSYLGFETYQVISQAAVVHATAKVEEILEQADYLYESGETEKLYQLLTQYKESEDAELLWRLARASRDVAQLSRTSEEEKKLLVYEALEYAKRALEKNESSFASHKWYAICLSDVGDYEGIKAKIANAYIIKEHFEKAIELNPKDATSIHLMGIWCYTFAEMPWYQRRIAKMLFATPPSSTYEKALGYFHRAEQVDPNFYSKNLLLLGKTYLKLHNKKLAAFWLMKAKDYPAHTEEDKQIQTEAAQLLTSFSEKN

• Full Name: family with sequence similarity 82, member B
• Calculated Molecular Weight: 314 aa, 36 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC009671
• Gene Symbol: FAM82B
• Gene ID (NCBI): 51115
• RRID: AB_3742128
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96DB5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FAM82B, also known as RMDN1 or CGI90, belongs to the FAM82/RMD family. FAM82B is a microtubule-associated protein with potential roles in regulating microtubule dynamics and other cellular functions.