FAM83B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• FAM83B Polyclonal antibody, PBS Only (26032-1-PBS)

• 

  WB analysis using 26032-1-AP (same clone as 26032-1-PBS)

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 26032-1-AP (FAM83B antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26032-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brown disease using 26032-1-AP (same clone as 26032-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brown disease slide using 26032-1-AP (FAM83B antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26032-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brown disease using 26032-1-AP (same clone as 26032-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brown disease slide using 26032-1-AP (FAM83B antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26032-1-PBS in a different storage buffer formulation.

FAM83B Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 26032-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

C6orf143

---

Product Information

26032-1-PBS targets FAM83B in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22951

  Product name: Recombinant human FAM83B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 653-1011 aa of BC112275

  Sequence: NQQTENLLKRRSFPLFDNSKANLDPGNSKHYVYSTLTRNRVRQPEKPKEDLLKSSKSMHNVTHNLEEDEEEVTKRNSPSGTTTKSVSIAALLDVNKEESNKELASKKEVKGSPSFLKKGSQKLRSLLSLTPDKKENLSKNKAPAFYRLCSSSDTLVSEGEENQKPKKSDTKVDSSPRRKHSSSSNSQGSIHKSKEDVTVSPSQEINAPPDENKRTPSPGPVESKFLERAGDASAPRFNTEQIQYRDSREINAVVNPERRPTSSPRPTSSELLRSHSTDRRVYSRFEPFCKIESSIQPTSNMPNTSINRPEIKSATMGNSYGRSSPLLNYNTGVYRSYQPNENKFRGFMQKFGNFIHKNK

• Full Name: family with sequence similarity 83, member B
• Calculated Molecular Weight: 1011 aa, 115 kDa
• Observed Molecular Weight: 115 kDa
• GenBank Accession Number: BC112275
• Gene Symbol: FAM83B
• Gene ID (NCBI): 222584
• RRID: AB_3085837
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5T0W9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

FAM83B, also known as C6orf143, belongs to the FAM83 family. FAM83B is an oncogene and promotes cell transformation through activating various pathway in different kinds of tumors. FAM83B over expressed in several kinds of malignant tumors, such as breast cancer, cervical cancer, endometrial cancer, pancreatic ductal adenocarcinoma, etc. Overexpression of FAM83B could promote the malignant biological behaviors of these tumors (PMID: 33423038, 36690987). The calculated molecular weight of FAM83B is 115 kDa.