FAM83H Polyclonal antibody

• Home
• Products
• Primary Antibodies
• FAM83H Polyclonal antibody (31974-1-AP)

• 

  WB analysis using 31974-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31974-1-AP (FAM83H antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

FAM83H Polyclonal Antibody for WB, ELISA

Cat No. 31974-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Protein FAM83H

---

Tested Applications

• Positive WB detected in: 5637 cells, A549 cells, HEK-293T cells, HT-1376 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31974-1-AP targets FAM83H in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37139

  Product name: Recombinant human FAM83H protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1000-1179 aa of BC033256

  Sequence: RRLSLGQGDSTEAATEERGPRARLSSATANALYSSNLRDDTKAILEQISAHGQKHRAVPAPSPGPTHNSPELGRPPAAGVLAPDMSDKDKCSAIFRSDSLGTQGRLSRTLPASAEERDRLLRRMESMRKEKRVYSRFEVFCKKEEASSPGAGEGPAEEGTRDSKVGKFVPKILGTFKSKK

• Full Name: family with sequence similarity 83, member H
• Calculated Molecular Weight: 127 kDa
• Observed Molecular Weight: 140 kDa
• GenBank Accession Number: BC033256
• Gene Symbol: FAM83H
• Gene ID (NCBI): 286077
• RRID: AB_3742503
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q6ZRV2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FAM83H was first discovered during extensive computational analysis of the human genomic sequence [PMID: 18252228] and reported to be essential in dental enamel formation [PMID: 26142250, PMID: 21127961]. Mutation of FAM83H is the main etiological factor for human autosomal dominant hypocalcified amelogenesis imperfecta. Moreover, recently, research into FAM83H has focused on its roles in the development and progression of human cancers. However, there are controversial reports for the role of FAM83H in human cancers. Earlier reports, which used microarray analysis, showed higher FAM83H expression in ovarian cancers compared with normal ovarian tissue [PMID: 21617380]. In addition, higher expression of the FAM83H gene is presented in the cancers of lung, breast, colon, liver, ovary, pancreas, and stomach [PMID: 28078827]. The roles of FAM83H in the progression of human cancers involve changes in the proliferation and invasiveness of cancer cells. In colon cancer cells, overexpression of FAM83H is suggested to be involved in the progression of cancer cells by disorganizing keratin cytoskeleton structures [PMID: 23902688, PMID: 27681590]. In addition, FAM83H increases proliferation of prostatic cancer cells [PMID: 26512949], hepatocellular carcinoma cells [PMID: 28607447], and clear cell renal cell carcinoma cells [PMID: 30723706]. In hepatocellular carcinoma cells, activation of the MYC-FAM83H pathway increases the proliferation and invasion activity of cancer cells [PMID: 28607447]. Moreover, higher expression of FAM83H is associated with an increased recurrence rate of prostatic cancer patients and shorter survival of uterine cancer [PMID: 28078827], hepatocellular carcinoma [PMID: 28607447], and clear cell renal cell carcinoma patients [PMID: 21057535]. These findings suggest that FAM83H has a vital role in tumorigenesis and progression of human malignant tumors, and might be involved in the progression of various types of human cancers. However, the expression of FAM83H is down-regulated in astrocytoma and oligodendroglioma of the brain, and higher expression of FAM83H is associated with favorable prognosis of glioma and head and neck cancer patients [PMID: 28078827]. Therefore, there is a possibility that the role of FAM83H might be different according to the type of cells and further study is needed [PMID: 21057535].