FAM92B/CIBAR2 Polyclonal antibody

FAM92B/CIBAR2 Polyclonal Antibody for WB, IF-P, ELISA
Cat No. 26413-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF-P, ELISA

FAM92B, Protein FAM92B, CIBAR2, CBY1-interacting BAR domain-containing protein 2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, COLO 320 cells, mouse small intestine tissue
Positive IF-P detected inmouse lung tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

IFSee 1 publications below

Product Information

26413-1-AP targets FAM92B/CIBAR2 in WB, IF-P, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivitymouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag24802

Product name: Recombinant human FAM92B protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 154-304 aa of BC111944

Sequence: VDSSRTTLQLEETVDGFQRQKLKDLQKFFCDFVTIEMVFHAKAVEVYSSAFQTLEKYDLERDLLDFRAKMQGVYGHYDTRLLANTSPPPSVLQSLASQGTLQVQLSRANEDPEHPHANHGRFSLCEWVVKGQPAHCVCGQGGHLMLPGHSL

Predict reactive species
Full Name family with sequence similarity 92, member B
Calculated Molecular Weight 304 aa, 35 kDa
Observed Molecular Weight 32-35 kDa
GenBank Accession NumberBC111944
Gene Symbol FAM92B
Gene ID (NCBI) 339145
RRIDAB_2880506
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ6ZTR7
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FAM92B (family with sequence similarity 92, member B, also named CIBAR2) is a transmembrane protein that plays a crucial role in various cellular processes, including membrane trafficking and cell adhesion. The protein is predicted to be intracellular and is involved in ciliogenesis, likely through the recruitment and fusion of endosomal vesicles at distal appendages during early stages of ciliogenesis.

Protocols

Product Specific Protocols
IF protocol for FAM92B/CIBAR2 antibody 26413-1-APDownload protocol
WB protocol for FAM92B/CIBAR2 antibody 26413-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIF

Life Sci Alliance

ciBAR1 loss in mice causes laterality defects, pancreatic degeneration, and altered glucose tolerance

Authors - Eunice N Kim

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Eunice (Verified Customer) (10-24-2022)

This was tested on mouse tracheal epithelial cells fixed in 4% PFA overnight and on MEFs fixed for 10 min in ice-cold methanol acetone. Works well.

  • Applications: Immunofluorescence, Cell culture
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Tracheal epithelial cells, mouse embryonic fibroblasts (MEFs)
Loading...
||
New chat Able
正在加载,请稍候...