FAM96A Polyclonal antibody

• 

  IP experiment of THP-1 using 20776-1-AP

  IP result of anti-FAM96A (IP:20776-1-AP, 4ug; Detection:20776-1-AP 1:600) with THP-1 cells lysate 2400 ug.

• 

  IP experiment of U-937 using 20776-1-AP

  IP result of anti-FAM96A (IP:20776-1-AP, 4ug; Detection:20776-1-AP 1:600) with U-937 cells lysate 2240 ug.

• 

  IHC staining of mouse colon using 20776-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 20776-1-AP (FAM96A antibody) at dilution of 1:100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat colon using 20776-1-AP

  Immunohistochemical analysis of paraffin-embedded rat colon tissue slide using 20776-1-AP (FAM96A antibody) at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A431 using 20776-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using FAM96A antibody (20776-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  IF Staining of U-251 using 20776-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed U-251 cells using FAM96A antibody (20776-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

FAM96A Polyclonal Antibody for IHC, IF/ICC, IP, ELISA

Cat No. 20776-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

CIA2A, CIAO2A, Cytosolic iron-sulfur assembly component 2A, MIP18 family protein FAM96A, Protein FAM96A

---

Tested Applications

• Positive IP detected in: U-937 cells, THP-1 cells
• Positive IHC detected in: mouse colon tissue, rat colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A431 cells, U-251 cells

Recommended dilution

• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

20776-1-AP targets FAM96A in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14770

  Product name: Recombinant human FAM96A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-90 aa of BC008865

  Sequence: MQRVSGLLSWTLSRVLWLSGLSEPGAARQPRIMEEKALEVYDLIRTIRDPEKPNTLEELEVVSESCVEVQEINEEEYLVIIRFTPTVPHC

• Full Name: family with sequence similarity 96, member A
• Calculated Molecular Weight: 160 aa, 18 kDa
• Observed Molecular Weight: 18-21 kDa
• GenBank Accession Number: BC008865
• Gene Symbol: FAM96A
• Gene ID (NCBI): 84191
• RRID: AB_3669346
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H5X1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FAM96A (family with sequence similarity 96, member A), also called cytosolic iron-sulfur assembly component 2A (CIAO2A), a recently identified member of the cytosolic iron-sulfur (Fe/S) protein assembly machinery and regulator of cellular iron homeostasis, is a novel pro-apoptotic APAF1-binding protein facilitating the effective induction of cell death via the mitochondrial apoptosis pathway. FAM96A is substantially enriched in macrophages comprised primarily of a DUF59 domain (residues 31-157) and an N-terminal signal peptide (residues 1-27), that is expressed at low levels in tumor cells (PMID: 29399066).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Biol Chem; Iron-Regulated Assembly of the Cytosolic Iron-Sulfur Cluster Biogenesis Machinery.; Authors - Xiaorui Fan