FANCE Polyclonal antibody

• Home
• Products
• Primary Antibodies
• FANCE Polyclonal antibody (32520-1-AP)

• 

  WB analysis using 32520-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32520-1-AP (FANCE antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

FANCE Polyclonal Antibody for WB, ELISA

Cat No. 32520-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

FACE, Fanconi anemia group E protein, Protein FACE

---

Tested Applications

• Positive WB detected in: HepG2 cells, THP-1 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32520-1-AP targets FANCE in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38546

  Product name: Recombinant human FANCE protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 274-535 aa of NM_021922.2

  Sequence: LAESLELPKAIQDQLPRLQQLLKTLEEGLEGLEDAPPVELQLLHECSPSQMDLLCAQLQLPQLSDLGLLRLCTWLLALSPDLSLSNATVLTRSLFLGRILSLTSSASRLLTTALTSFCAKYTYPVCSALLDPVLQAPGTGPAQTELLCCLVKMESLEPDAQVLMLGQILELPWKEETFLVLQSLLERQVEMTPEKFSVLMEKLCKKGLAATTSMAYAKLMLTVMTKYQANITETQRLGLAMALEPNTTFLRKSLKAALKHLGP

• Full Name: Fanconi anemia, complementation group E
• Calculated Molecular Weight: 59 kDa，536aa
• Observed Molecular Weight: 59 kDa
• GenBank Accession Number: NM_021922.2
• Gene Symbol: FANCE
• Gene ID (NCBI): 2178
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9HB96
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Fanconi anemia group E protein (FANCE) is primarily localized in the nucleoplasm, with additional distribution in mitotic chromosomes and centrosomes. As a key component of the Fanconi anemia (FA) core complex, it plays an essential role in DNA interstrand cross-link repair, serving as a critical bridge between the FA complex and FANCD2 protein (PMID: 12239156; 12093742; 17308347). Cells with FANCE defects exhibit hypersensitivity to DNA cross-linking agents, chromosomal instability, and impaired DNA repair capacity (PMID: 21948210; 28239445; 37563658).