FANK1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• FANK1 Polyclonal antibody, PBS Only (17167-1-PBS)

• 

  WB analysis using 17167-1-AP (same clone as 17167-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 17167-1-AP (FANK1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17167-1-PBS in a different storage buffer formulation.

FANK1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 17167-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

UNQ6504/PRO21382, HSD13

---

Product Information

17167-1-PBS targets FANK1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10639

  Product name: Recombinant human FANK1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-345 aa of BC024189

  Sequence: MEPQRIMPPSKPHPPVVGKVTHHSIELYWDLEKKAKRQGPQEQWFRFSIEEEDPKMHTYGIIYTGYATKHVVEGLEPRTLYRFRLKVTSPSGECEYSPLVSVSTTREPISSEHLHRAVSVNDEDLLVRILQGGRVKVDVPNKFGFTALMVAAQKGYTRLVKILVSNGTDVNLKNGSGKDSLMLACYAGHLDVVKYLRRHGASWQARDLGGCTALHWAADGGHCSVIEWMIKDGCEVDVVDTGSGWTPLMRVSAVSGNQRVASLLIDAGANVNVKDRNGKTPLMVAVLNNHEELVQLLLDKGADASVKNEFGKGVLEMARVFDRQSVVSLLEERKKKQRPKKSCVC

• Full Name: fibronectin type III and ankyrin repeat domains 1
• Calculated Molecular Weight: 345 aa, 38 kDa
• Observed Molecular Weight: 38-40 kDa
• GenBank Accession Number: BC024189
• Gene Symbol: FANK1
• Gene ID (NCBI): 92565
• RRID: AB_3669264
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TC84
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

FANK1 (Fibronectin type 3 and ankyrin repeat domains protein 1), also known as HSD13. It is expected to be located in the nucleus. And mostly restricted to testis (PMID: 17604233). Fibronectin type III and ankyrin repeat domains 1(Fank1) is a nuclear protein expressed during the transition from the meiotic phase to the haploid phase of spermatogenesis. While little is known about the function of Fank1 during spermatogenesis, gene ontology analysis suggests that it may be a transcription factor. H. Wang explored the role of Fank1 using the yeast two-hybrid system to screen for cellular proteins that may interact with Fank1. In this screen, they identified the Jun activation domain-binding protein 1 (Jab1) as a potential Fank1-interacting protein (PMID: 20978819).