FAR2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• FAR2 Polyclonal antibody, PBS Only (27717-1-PBS)

• 

  WB analysis using 27717-1-AP (same clone as 27717-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27717-1-AP (FAR2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27717-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 27717-1-AP (same clone as 27717-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 27717-1-AP (FAR2 antibody) at dilution of 1:600 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27717-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 27717-1-AP (same clone as 27717-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 27717-1-AP (FAR2 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27717-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 27717-1-AP (same clone as 27717-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 27717-1-AP (FAR2 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27717-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 27717-1-AP (same clone as 27717-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 27717-1-AP (FAR2 antibody) at dilution of 1:600 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27717-1-PBS in a different storage buffer formulation.

FAR2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 27717-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

HEL-S-81, MLSTD1, SDR10E2

---

Product Information

27717-1-PBS targets FAR2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26819

  Product name: Recombinant human FAR2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 52-104 aa of BC022267

  Sequence: LQQRVFQILDSKLFEKVKEVCPNVHEKIRAIYADLNQNDFAISKEDMQELLSC

• Full Name: fatty acyl CoA reductase 2
• Calculated Molecular Weight: 515 aa, 59 kDa
• Observed Molecular Weight: 59 kDa
• GenBank Accession Number: BC022267
• Gene Symbol: FAR2
• Gene ID (NCBI): 55711
• RRID: AB_3669618
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96K12
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Fatty acyl-CoA reductase 2 (FAR2), also known as MLSTD1, belongs to the fatty acyl-CoA reductase family. FAR2 catalyzes the reduction of saturated but not unsaturated C16 or C18 fatty acyl-CoA to fatty alcohols (PMID: 24009241). FAR2 may play a role in the production of ether lipids/plasmalogens and wax monoesters which synthesis requires fatty alcohols as substrates. FAR2 has 2 isoforms with the molecular mass of 49 kDa and 59 kDa (Refer to Uniprot).