FARP1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• FARP1 Polyclonal antibody, PBS Only (24014-1-PBS)

• 

  WB analysis using 24014-1-AP (same clone as 24014-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 24014-1-AP (FARP1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24014-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 24014-1-AP (same clone as 24014-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 24014-1-AP (FARP1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24014-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 24014-1-AP (same clone as 24014-1-PBS)

  IP result of anti-FARP1 (IP:24014-1-AP, 4ug; Detection:24014-1-AP 1:1000) with HeLa cells lysate 1200 ug. This data was developed using the same antibody clone with 24014-1-PBS in a different storage buffer formulation.

FARP1 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 24014-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, Indirect ELISA

Synonyms

Pleckstrin homology domain-containing family C member 2, PH domain-containing family C member 2, FERM, RhoGEF and pleckstrin domain-containing protein 1, FERM, ARHGEF and pleckstrin domain-containing protein 1, Chondrocyte-derived ezrin-like protein

---

Product Information

24014-1-PBS targets FARP1 in WB, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21225

  Product name: Recombinant human FARP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 347-539 aa of BC071592

  Sequence: VLDYVKEGGHKKVQFERKHSKIHSIRSLASQPTELNSEVLEQSQQSTSLTFGEGAESPGGQSCRRGKEPKVSAGEPGSHPSPAPRRSPAGNKQADGAASAPTEEEEEVVKDRTQQSKPQPPQPSTGSLTGSPHLSELSVNSQGGVAPANVTLSPNLSPDTKQASPLISPLLNDQACPRTDDEDEGRRKRFPTD

• Full Name: FERM, RhoGEF (ARHGEF) and pleckstrin domain protein 1 (chondrocyte-derived)
• Calculated Molecular Weight: 1076 aa, 122 kDa
• Observed Molecular Weight: 122 kDa
• GenBank Accession Number: BC071592
• Gene Symbol: FARP1
• Gene ID (NCBI): 10160
• RRID: AB_3085720
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q9Y4F1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

FARP1 is a protein containing a FERM (4.2, exrin, radixin, moesin) domain, a Dbl homology domain, and two pleckstrin homology domains. These domains are found in guanine nucleotide exchange factors and proteins that link the cytoskeleton to the cell membrane. The encoded protein functions in neurons to promote dendritic growth.