CD178/Fas Ligand Polyclonal antibody

• 

Fas Ligand Polyclonal Antibody for ELISA

Cat No. 11322-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, ELISA

Synonyms

Apoptosis antigen ligand, APT1LG1, APTL, CD178, CD95 L, CD95 ligand, CD95L, Fas antigen ligand, Fas ligand, FASL, FASLG, TNFSF6

---

Published Applications

• WB: See 4 publications below

Product Information

11322-1-AP targets Fas Ligand in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1816

  Product name: Recombinant human FASL,FASLG protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-281 aa of BC017502

  Sequence: MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPPPPLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

• Full Name: Fas ligand (TNF superfamily, member 6)
• Calculated Molecular Weight: 281 aa, 31 kDa
• GenBank Accession Number: BC017502
• Gene Symbol: Fas Ligand
• Gene ID (NCBI): 356
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P48023
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Biochem Mol Toxicol; Identification of apoptosis-associated protein factors distinctly expressed in cigarette smoke condensate-exposed airway bronchial epithelial cells.; Authors - Ben-Cheng Lin
pig	WB	Comp Biochem Physiol C Toxicol Pharmacol; Effects of Hericium erinaceus polysaccharide in porcine IPEC-J2 intestinal epithelial cells against apoptosis induced by oxidative stress; Authors - Jian Li
mouse	WB	J Tradit Chin Med; Matrine alleviates coronary microvascular dysfunction in ischemia with non-obstructive coronary artery disease mice induced by advanced glycation end products inhibition of the reactive oxygen species-mediated endoplasmic reticulum stress in cardiac microvascular endothelial cells; Authors - D U Haixia
human	WB	Int J Biol Macromol; Ionized Angelica polysaccharides derivatives slow tumor growth in vivo and induce the apoptosis of HepG2 cells via mitochondria death receptor-mediated pathways in vitro; Authors - Yanmei Yang