FASN Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• FASN Recombinant monoclonal antibody, PBS Only (81079-2-PBS)

FASN Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 81079-2-PBS

Clone No.260308B2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

FAS, fatty acid synthase, Type I fatty acid synthase

• 

  WB analysis using 81079-2-RR (same clone as 81079-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 81079-2-RR (FASN antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 81079-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 81079-2-RR (same clone as 81079-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 81079-2-RR (FASN antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 81079-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat liver using 81079-2-RR (same clone as 81079-2-PBS)

  rat liver tissue were subjected to SDS PAGE followed by western blot with 81079-2-RR (FASN antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 81079-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

81079-2-PBS targets FASN in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0975

  Product name: Recombinant human FASN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 142-439 aa of BC007909

  Sequence: QTQLNLRSLLVNPEGPTLMRLNSVQSSERPLFLVHPIEGSTTVFHSLASRLSIPTYGLQCTRAAPLDSIHSLAAYYIDCIRQVQPEGPYRVAGYSYGACVAFEMCSQLQAQQSPAPTHNSLFLFDGSPTYVLAYTQSYRAKLTPGCEAEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAAAVDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKTGGAYGEDLGADYNLSQVCDGKVSVHVIEGDHRTLLEGSGLESIISIIHSSLAEPRVSVREG

• Full Name: fatty acid synthase
• Calculated Molecular Weight: 272 kDa
• Observed Molecular Weight: 250-272 kDa
• GenBank Accession Number: BC007909
• Gene Symbol: FASN
• Gene ID (NCBI): 2194
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P49327
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

FASN gene codes for an enzyme essential for de novo fatty acid synthesis and cellular substrate energy metabolism. Active FASN is a homodimer in which each peptide subunit has a molecular weight of 260 kDa. FASN is overexpressed in various types of cancer including glioblastomas and is a potential therapeutic target. Recently FASN has been reported to contribute to the neurogenesis since FASN mutation caused intellectual disability in mice.