FASTKD5 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• FASTKD5 Polyclonal antibody, PBS Only (20488-1-PBS)

• 

  IF Staining of A431 using 20488-1-AP (same clone as 20488-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using FASTKD5 antibody (20488-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red). This data was developed using the same antibody clone with 20488-1-PBS in a different storage buffer formulation.

FASTKD5 Polyclonal Antibody for IF/ICC, Indirect ELISA

Cat No. 20488-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, Indirect ELISA

Synonyms

FAST kinase domains 5, KIAA1792

---

Product Information

20488-1-PBS targets FASTKD5 in IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14517

  Product name: Recombinant human FASTKD5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 415-764 aa of BC007413

  Sequence: AASLPPRVAHCRSKDVAKILWSFGTLNYKPPNAEEFYSSLISEIHRKMPEFNQYPEHLPTCLLGLAFLEYFPVELIDFALSPGFVRLAQERTKFDLLKELYTLDGTVGIECPDYRGNRLSTHLQQEGSELLWYLAEKDMNSKPEFLETVFLLETMLGGPQYVKHHMILPHTRSSDLEVQLDVNLKPLPFNREATPAENVAKLRLEHVGVSLTDDLMNKLLKGKARGHFQGKTESEPGQQPMELENKAAVPLGGFLCNVADKSGAMEMAGLCPAACMQTPRMKLAVQFTNRNQYCYGSRDLLGLHNMKRRQLARLGYRVVELSYWEWLPLLKRTRLEKLAFLHEKVFTSAL

• Full Name: FAST kinase domains 5
• Calculated Molecular Weight: 764 aa, 87 kDa
• GenBank Accession Number: BC007413
• Gene Symbol: FASTKD5
• Gene ID (NCBI): 60493
• RRID: AB_3741998
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7L8L6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

FASTKD5 (FAST Kinase Domains 5) is a mitochondrial matrix protein localized within the mitochondrial RNA granules (MRGs) found in close proximity to the mitochondrial nucleoids .(PMID: 40637235, PMID: 29932989)