FATS Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• FATS Polyclonal antibody, PBS Only (30190-1-PBS)

• 

  WB analysis using 30190-1-AP (same clone as 30190-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30190-1-AP (FATS antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30190-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 30190-1-AP (same clone as 30190-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using FATS antibody (30190-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 30190-1-PBS in a different storage buffer formulation.

FATS Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 30190-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

30190-1-PBS targets FATS in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32956

  Product name: Recombinant human C10orf90 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 169-400 aa of NM_001004298.2

  Sequence: AEDTLFQAPPALANGAHPGRHQRSFACTEFSRNSSVVRLKVPEAHTGLCERRKYWVTHADDKETSFSPDTPLSGKSPLVFSSCVHLRVSQQCPDSIYYVDKSLSVPIEPPQIASPKMHRSVLSLNLNCSSHRLTADGVDGLVNREPISEALKQELLEGDQDLVGQRWNPGLQESHLKETPSLRRVHLGTGACPWSGSFPLENTELANVGANQVTVRKGEKDHTTHCHASDHA

• Full Name: chromosome 10 open reading frame 90
• Calculated Molecular Weight: 78 kDa
• Observed Molecular Weight: 67-77 kDa
• GenBank Accession Number: NM_001004298.2
• Gene Symbol: FATS/C10orf90
• Gene ID (NCBI): 118611
• RRID: AB_2935528
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96M02
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

FATS, also known as centrosomal protein C10orf90, bA422P15.2, belongs to a novel class of enzymes that acts as an E2-E3 hybrid enzyme for assembly of polyubiquitin chains. FATS is an E2-independent ubiquitin ligase that stabilizes p53 and promotes its activation in response to DNA damage (PMID: 24240685). FATS acts as a p53/TP53 activator by inhibiting MDM2 binding to p53/TP53 and stimulating non-proteolytic polyubiquitination of p53/TP53.