Tested Applications
| Positive WB detected in | mouse skeletal muscle tissue, rat skeletal muscle tissue |
| Positive IHC detected in | human small intestine tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
25192-1-AP targets FBP2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18245 Product name: Recombinant human FBP2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 283-339 aa of BC113632 Sequence: NPVAYIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKNQAGS Predict reactive species |
| Full Name | fructose-1,6-bisphosphatase 2 |
| Calculated Molecular Weight | 339 aa, 37 kDa |
| Observed Molecular Weight | 37 kDa |
| GenBank Accession Number | BC113632 |
| Gene Symbol | FBP2 |
| Gene ID (NCBI) | 8789 |
| RRID | AB_2879951 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O00757 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
FBP2, also named muscle FBP, belongs to the FBPase class 1 family. FBP2 is a ubiquitously expressed enzyme of glycogen synthesis from non-carbohydrates, e.g., lactate (glyconeogenesis). However, it also plays a variety of non-enzymatic functions. FBP2 is involved in the regulation of hypoxia-inducible factor 1 (Hif1 ) stability, cell cycle-dependent events, biogenesis of mitochondria, and protection of the organelles against high reactive oxygen species (ROS)- and high Ca2+-induced stress (PMID: 32962293, PMID: 35626746). The calculated molecular weight of FBP2 is 37 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for FBP2 antibody 25192-1-AP | Download protocol |
| WB protocol for FBP2 antibody 25192-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The FBP2 Polyclonal antibody (Cat# 25192-1-AP) has 5 total citations published in J Anim Sci Biotechnol, Food Funct, Biomolecules, Sci Rep, and FASEB J. The associated research fields include hepatic gluconeogenesis via TGR5 signaling, FBP2 gene promoter demethylation in hepatocytes, muscle atrophy proteomics, gravity-loading effects on muscle proteins, and skeletal muscle contractile dysfunction.
| Species | Application | Title |
|---|---|---|
J Anim Sci Biotechnol Taurodeoxycholic, taurocholic, and glycocholic acids promote hepatic gluconeogenesis via TGR5 in dairy cows. | ||
Food Funct Free fatty acids induce the demethylation of the fructose 1,6-biphosphatase 2 gene promoter and potentiate its expression in hepatocytes. | ||
Biomolecules Integrated Proteomic and Metabolomic Analysis of Muscle Atrophy Induced by Hindlimb Unloading. | ||
Sci Rep Identification of mouse soleus muscle proteins altered in response to changes in gravity loading | ||
FASEB J Overexpression of enhanced yellow fluorescent protein fused with Channelrhodopsin-2 causes contractile dysfunction in skeletal muscle |
