Product Information
83910-5-PBS targets FBP2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag18245 Product name: Recombinant human FBP2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 283-339 aa of BC113632 Sequence: NPVAYIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKNQAGS Predict reactive species |
| Full Name | fructose-1,6-bisphosphatase 2 |
| Calculated Molecular Weight | 339 aa, 37 kDa |
| Observed Molecular Weight | 37 kDa |
| GenBank Accession Number | BC113632 |
| Gene Symbol | FBP2 |
| Gene ID (NCBI) | 8789 |
| RRID | AB_3671492 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purfication |
| UNIPROT ID | O00757 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
FBP2, also named muscle FBP, belongs to the FBPase class 1 family. FBP2 is a ubiquitously expressed enzyme of glycogen synthesis from non-carbohydrates, e.g., lactate (glyconeogenesis). However, it also plays a variety of non-enzymatic functions. FBP2 is involved in the regulation of hypoxia-inducible factor 1 (Hif1) stability, cell cycle-dependent events, biogenesis of mitochondria, and protection of the organelles against high reactive oxygen species (ROS)- and high Ca2+-induced stress (PMID: 32962293, PMID: 35626746). The calculated molecular weight of FBP2 is 37 kDa.













