FBXL16 Polyclonal antibody

• 

  WB analysis of HeLa using 25950-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 25950-1-AP (FBXL16 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human brain using 25950-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 25950-1-AP (FBXL16 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human brain using 25950-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 25950-1-AP (FBXL16 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

FBXL16 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 25950-1-AP

Publications(1)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

C16orf22, c380A1.1, F box/LRR repeat protein 16, Fbl16, FBXL16

---

Tested Applications

• Positive WB detected in: HeLa cells
• Positive IHC detected in: human brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IHC: See 1 publications below

Product Information

25950-1-AP targets FBXL16 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22827

  Product name: Recombinant human FBXL16 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 124-479 aa of BC036680

  Sequence: WRRVLYQPKFWAGLTPVLHAKELYNVLPGGEKEFVNLQGFAARGFEGFCLVGVSDLDICEFIDNYALSKKGVKAMSLKRSTITDAGLEVMLEQMQGVVRLELSGCNDFTEAGLWSSLSARITSLSVSDCINVADDAIAAISQLLPNLAELSLQAYHVTDTALAYFTARQGHSTHTLRLLSCWEITNHGVVNVVHSLPNLTALSLSGCSKVTDDGVELVAENLRKLRSLDLSWCPRITDMALEYVACDLHRLEELVLDRCVRITDTGLSYLSTMSSLRSLYLRWCCQVQDFGLKHLLALGSLRLLSPAGCPLLTTTGLSGLVQLQELEELELTNCPGATPELFKYFSQHLPRCLVIE

• Full Name: F-box and leucine-rich repeat protein 16
• Calculated Molecular Weight: 479 aa, 52 kDa
• Observed Molecular Weight: 52 kDa
• GenBank Accession Number: BC036680
• Gene Symbol: FBXL16
• Gene ID (NCBI): 146330
• RRID: AB_2880307
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N461
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Nat Chem Biol; LATS2 condensates organize signalosomes for Hippo pathway signal transduction; Authors - Min Qin

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Nazia (Verified Customer) (01-06-2022)

Package arrived very quickly and staff were very helpful. Product worked just as expected. Great customer service. I will be recommending ProteinTech to colleagues in my lab.

• Applications: Western Blot