FBXL17 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• FBXL17 Polyclonal antibody, PBS Only (24476-1-PBS)

• 

  WB analysis using 24476-1-AP (same clone as 24476-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 24476-1-AP (FBXL17 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24476-1-PBS in a different storage buffer formulation.

FBXL17 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 24476-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

Fbl17, Fbx13, FBXL 17, FBXO13

---

Product Information

24476-1-PBS targets FBXL17 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20436

  Product name: Recombinant human FBXL17 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 399-701 aa of BC126144

  Sequence: MSDNGVCVLAFKCPGLLRYTAYRCKQLSDTSIIAVASHCPLLQKVHVGNQDKLTDEGLKQLGSKCRELKDIHFGQCYKISDEGMIVIAKGCLKLQRIYMQENKLVTDQSVKAFAEHCPELQYVGFMGCSVTSKGVIHLTKLRNLSSLDLRHITELDNETVMEIVKRCKNLSSLNLCLNWIINDRCVEVIAKEGQNLKELYLVSCKITDYALIAIGRYSMTIETVDVGWCKEITDQGATLIAQSSKSLRYLGLMRCDKVNEVTVEQLVQQYPHITFSTVLQDCKRTLERAYQMGWTPNMSAASS

• Full Name: F-box and leucine-rich repeat protein 17
• Calculated Molecular Weight: 701 aa, 76 kDa
• Observed Molecular Weight: 76 kDa
• GenBank Accession Number: BC126144
• Gene Symbol: FBXL17
• Gene ID (NCBI): 64839
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UF56
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

FBXL17 (F-box and leucine-rich repeat protein 17) is a substrate-recognition component of the SCF-type E3 ubiquitin ligase complex (SKP1-CUL1-F-box).