FBXO2 Polyclonal antibody

• 

  WB analysis using 14590-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14590-1-AP (FBXO2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 14590-1-AP

  SH-SY5Y lysates were subjected to SDS PAGE followed by western blot with 14590-1-AP (FBXO2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 14590-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 14590-1-AP (FBXO2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 14590-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 14590-1-AP (FBXO2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat brain using 14590-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain using 14590-1-AP (FBXO2 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of rat brain using 14590-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain using 14590-1-AP (FBXO2 antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of rat cerebellum using 14590-1-AP

  Immunohistochemical analysis of paraffin-embedded rat cerebellum using 14590-1-AP (FBXO2 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of rat cerebellum using 14590-1-AP

  Immunohistochemical analysis of paraffin-embedded rat cerebellum using 14590-1-AP (FBXO2 antibody) at dilution of 1:50 (under 40x lens).

• Featured Product
• KD/KO Validated

FBXO2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 14590-1-AP

Publications(12)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, CoIP, ELISA

Synonyms

FBG1, F-box only protein 2, Fbs1, FBX2, NFB42

---

Tested Applications

• Positive WB detected in: SH-SY5Y cells, Caco-2 cells, HCT 116 cells, LoVo cells
• Positive IHC detected in: mouse brain tissue, rat brain tissue, rat cerebellum tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 5 publications below
• WB: See 10 publications below
• IHC: See 7 publications below
• IF: See 3 publications below
• IP: See 3 publications below
• CoIP: See 2 publications below

Product Information

14590-1-AP targets FBXO2 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6122

  Product name: Recombinant human FBXO2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-296 aa of BC025233

  Sequence: MDGDGDPESVGQPEEASPEEQPEEASAEEERPEDQQEEEAAAAAAYLDELPEPLLLRVLAALPAAELVQACRLVCLRWKELVDGAPLWLLKCQQEGLVPEGGVEEERDHWQQFYFLSKRRRNLLRNPCGEEDLEGWCDVEHGGDGWRVEELPGDSGVEFTHDESVKKYFASSFEWCRKAQVIDLQAEGYWEELLDTTQPAIVVKDWYSGRSDAGCLYELTVKLLSEHENVLAEFSSGQVAVPQDSDGGGWMEISHTFTDYGPGVRFVRFEHGGQDSVYWKGWFGARVTNSSVWVEP

• Full Name: F-box protein 2
• Calculated Molecular Weight: 33 kDa
• Observed Molecular Weight: 33-40 kDa
• GenBank Accession Number: BC025233
• Gene Symbol: FBXO2
• Gene ID (NCBI): 26232
• RRID: AB_2104394
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UK22
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

F-box only protein 2 (FBXO2), also known as FBG1 or Fbs1, is a cytoplasmic protein and ubiquitin ligase with high-mannose glycoprotein specificity. FBXO2 plays a significant role in regulating normal and abnormal neuron functions as a ubiquitin-mediated degrader of several neuron glycoproteins. In addition, it has been reported that FBXO2 targets insulin receptors for degradation by ubiquitin, thereby modulating insulin signaling. Recently, emerging evidence demonstrated that FBXO2 was also strongly associated with the occurrence and development of malignant tumors, including gastric cancer and colorectal cancer. The overexpression of FBXO2 significantly promotes PTC cell proliferation (PMID: 39343799). Lactic acid mediates the selective loading of FBXO2 into SEVs through SORBS3/FLOT1, thereby inducing hepatocyte apoptosis, which is an important mechanism of liver fibrosis caused by myogenic SEVs (PMID: 39879982).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Sci Rep; Quantitative proteomics by SWATH-MS reveals sophisticated metabolic reprogramming in hepatocellular carcinoma tissues.; Authors - Yanyan Gao
human	WB,IHC,CoIP	Cell Oncol (Dordr); Fbxo2 inhibits cell proliferation, migration and invasion by the ubiquitin-mediated degradation of WEE1 in renal cell carcinoma; Authors - Lixia Wang ; KD Validated
human	WB,IHC	Biochem Biophys Res Commun; FBXO2, a novel marker for metastasis in human gastric cancer.; Authors - Sun Xu
mouse	IF	Stem Cells; Early Wnt Signaling Activation Promotes Inner Ear Differentiation via Cell Caudalization in Mouse Stem Cell-Derived Organoids; Authors - Pei-Ciao Tang
mouse	WB,IP	Cell Metab; Muscle-derived small extracellular vesicles induce liver fibrosis during overtraining; Authors - Ya Liu
mouse	WB,IHC,CoIP	Nat Commun; Inhibition of histone methyltransferase Smyd3 rescues NMDAR and cognitive deficits in a tauopathy mouse model; Authors - Jamal B Williams