FBXO22 Monoclonal antibody, PBS Only

• 

  WB analysis of Jurkat using 68650-1-Ig (same clone as 68650-1-PBS)

  WB result of FBXO22 antibody (68650-1-Ig; 1:4000; room temperature for 1.5 hours) with wild-type and FBXO22 knockout Jurkat cells. This data was developed using the same antibody clone with 68650-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 68650-1-Ig (same clone as 68650-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68650-1-Ig (FBXO22 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68650-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

FBXO22 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 68650-1-PBS

Clone No.4B8A12

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

FBX22, F-box protein FBX22p44, F-box only protein 22, F box protein 22, F box only protein 22

---

Product Information

68650-1-PBS targets FBXO22 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5294

  Product name: Recombinant human FBXO22 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-299 aa of BC039024

  Sequence: MADSETFISLEECRGHKRARKRTSMETALALEKLFPKQCQVLGIVTPGIVVTPMGSGSNRPQEIEIGESGFALLFPQIEGIKIQPFHFIKDPKNLTLERHQLTEVGLLDNPELRVVLVFGYNCCKVGASNYLQQVVSTFSDMNIILAGGQVDNLSSLTSEKNPLDIDASGVVGLSFSGHRIQSATVLLNEDVSDEKTAEAAMQRLKAANIPEHNTIGFMFACVGRGFQYYRAKGNVEADAFRKFFPSVPLFGFFGNGEIGCDRIVTGNFILRKCNEVKDDDLFHSYTTIMALIHLGSSK

• Full Name: F-box protein 22
• Calculated Molecular Weight: 403 aa, 45 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC039024
• Gene Symbol: FBXO22
• Gene ID (NCBI): 26263
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q8NEZ5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

FBXO22, also named as FBX22, is a substrate-recognition of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex. FBXO22 is a key regulator of senescence induction through ubiquitylation of p53 for degradation. FBXO22 also acts as a molecular switch for the antagonistic and agonistic actions of selective estrogen receptor modulators (SERM) and determines the sensitivity of breast cancer to SERM by ubiquitylating KDM4B complexed with unliganded or SERMs‐bound estrogen receptor (ER). (PMID: 32536008, PMID: 32249768)