FBXO3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• FBXO3 Polyclonal antibody, PBS Only (17803-1-PBS)

• 

  WB analysis of HeLa using 17803-1-AP (same clone as 17803-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 17803-1-AP (FBXO3 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17803-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 17803-1-AP (same clone as 17803-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 17803-1-AP (FBXO3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17803-1-PBS in a different storage buffer formulation.

FBXO3 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 17803-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

17803-1-PBS targets FBXO3 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12071

  Product name: Recombinant human FBXO3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 124-471 aa of BC046110

  Sequence: EEDLDAVEAQIGCKLPDDYRCSYRIHNGQKLVVPGLLGSMALSNHYRSEDLLDVDTAAGGFQQRQGLKYCLPLTFCIHTGLSQYIAVEAAEGRNKNEVFYQCPDQMARNPAAIDMFIIGATFTDWFTSYVKNVVSGGFPIIRDQIFRYVHDPECVATTGDITVSVSTSFLPELSSVHPPHYFFTYRIRIEMSKDALPEKACQLDSRYWRITNAKGDVEEVQGPGVVGEFPIISPGRVYEYTSCTTFSTTSGYMEGYYTFHFLYFKDKIFNVAIPRFHMACPTFRVSIARLEMGPDEYEEMEEEEEEEEEEDEDDDSADMDESDEDDEEERRRRVFDVPIRRRRCSRLF

• Full Name: F-box protein 3
• Calculated Molecular Weight: 471 aa, 55 kDa
• Observed Molecular Weight: 48-50 kDa
• GenBank Accession Number: BC046110
• Gene Symbol: FBXO3
• Gene ID (NCBI): 26273
• RRID: AB_2278445
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UK99
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.