FBXO32 Recombinant monoclonal antibody, PBS Only

FBXO32 Uni-rAb® Recombinant Antibody for IHC, IF/ICC, FC (Intra), Indirect ELISA
Cat No. 82941-1-PBS
Clone No.230243H7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF/ICC, FC (Intra), Indirect ELISA

230243H7, Atrogin 1, Atrogin-1, F box only protein 32, F box protein 32

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

82941-1-PBS targets FBXO32 in IHC, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag29394

Product name: Recombinant human FBXO32 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 50-120 aa of BC024030

Sequence: MWVYRMETILHWQQQLNNIQITRPAFKGLTFTDLPLCLQLNIMQRLSDGRDLVSLGQAAPDLHVLSEDRLL

Predict reactive species
Full Name F-box protein 32
Calculated Molecular Weight 355 aa, 42 kDa
GenBank Accession NumberBC024030
Gene Symbol FBXO32
Gene ID (NCBI) 114907
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ969P5
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

FBXO32 (F box only protein 32), also known as Atrogin 1 or MAFbx, is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif F-box. This protein is an E3 ubiquitin ligase that is markedly up-regulated in muscle atrophy. FBXO32 is thus a potential drug target for the treatment of muscle atrophy. Some data support that FBXO32 may play an important role in tumorigenesis. Recent study reveal that FBXO32 targets the oncogenic protein c-Myc for ubiquitination and degradation through the proteasome pathway.

Loading...
||
New chat Able
正在加载,请稍候...