CoraLite® Plus 488-conjugated FBXO38 Recombinant monoclonal antibody

FBXO38 Recombinant Antibody for IF/ICC
Cat No. CL488-83509-5
Clone No.240513A4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

SP329, MOKA, Fbx38, F box protein 38, F box only protein 38

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-83509-5 targets FBXO38 in IF/ICC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag35444

Product name: Recombinant human FBXO38 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 490-700 aa of XM_005268513.1

Sequence: SNQNSNNDDNNAQNNNANIHDNNHHHPDDSDEENDFRQDLQPGEQQFAADALNEMEDIVQEDGEVVAESGNNTPAHSQAIIPVDVDEEQAGPSGLQRVVKPTSITVHDSESDDEEDSLELQEVWIPKNGTRRYSEREEKTGESVQSRELSVSGKGKTPLRKRYNSHQMGQSKQFPLEESSCEKGCQVTSEQIKADMKAARDIPEKKKNKDV

Predict reactive species
Full Name F-box protein 38
Calculated Molecular Weight134kDa,1188aa
GenBank Accession NumberXM_005268513.1
Gene Symbol FBXO38
Gene ID (NCBI) 81545
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ6PIJ6
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

FBXO38, also known as HMN2D, MOKA, and SP329, is a protein that plays a significant role in the regulation of immune responses, particularly in the context of cancer and autoimmune diseases. FBXO38 has been identified as an E3 ubiquitin ligase that mediates the degradation of PD-1 (Programmed cell death protein 1), a key immune checkpoint protein expressed on the surface of T cells. The internalization, ubiquitination, and proteasome degradation of PD-1 are facilitated by FBXO38, which links PD-1 to Lys48, leading to its poly-ubiquitination and subsequent degradation (PMID: 30487606).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 FBXO38 antibody CL488-83509-5Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...