FBXO42 Polyclonal antibody

• 

  WB analysis using 17806-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17806-1-AP (FBXO42 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

FBXO42 Polyclonal Antibody for WB, ELISA

Cat No. 17806-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

F box only protein 42, F box protein 42, F-box only protein 42, FBX42, JFK

---

Tested Applications

• Positive WB detected in: A549 cells, HeLa cells, HepG2 cells, Jurkat cells, PC-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17806-1-AP targets FBXO42 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12084

  Product name: Recombinant human FBXO42 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-343 aa of BC063864

  Sequence: MASSSDSEDDSFMAVDQEETVLEGTMDQDEEPHPVLEAEETRHNRSMSELPEEVLEYILSFLSPYQEHKTAALVCKQWYRLIKGVAHQCYHGFMKAVQEGNIQWESRTYPYPGTPITQRFSHSACYYDANQSMYVFGGCTQSSCNAAFNDLWRLDLNSKEWIRPLASGSYPSPKAGATLVVYKDLLVLFGGWTRPSPYPLHQPERFFDEIHTYSPSKNWWNCIVTTHGPPPMAGHSSCVIDDKMIVFGGSLGSRQMSNDVWVLDLEQWAWSKPNISGPSPHPRGGQSQIVIDDATILILGGCGGPNALFKDAWLLHMHSGPWAWQPLKVENEEHGAPELWCHP

• Full Name: F-box protein 42
• Calculated Molecular Weight: 7171 aa, 78 kDa
• Observed Molecular Weight: 75 kDa
• GenBank Accession Number: BC063864
• Gene Symbol: FBXO42
• Gene ID (NCBI): 54455
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6P3S6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FBXO42 is an F-box protein that serves as a substrate recognition component of the SCF (SKP1-CUL1-F-box protein) E3 ubiquitin ligase complex. It plays a critical role in regulating protein degradation, cell cycle progression, and cellular processes such as chromosome alignment and spindle assembly during mitosis.