FBXO44 Polyclonal antibody

• 

  WB analysis using 30162-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30162-1-AP (FBXO44 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 30162-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 30162-1-AP (FBXO44 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 30162-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 30162-1-AP (FBXO44 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

FBXO44 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 30162-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

DKFZp781J0852, F box only protein 44, F box protein 44, F box protein FBX30, F box/G domain protein 3, FBG3, FBX30, Fbx44, FBX6A, FBXO44, Fbxo6a

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30162-1-AP targets FBXO44 in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32432

  Product name: Recombinant human FBXO44 protein

  Source: e coli.-derived, PKG

  Tag: GST

  Domain: 82-122 aa of BC007832

  Sequence: LHNPCAEEGFEFWSLDVNGGDEWKVEDLSRDQRKEFPNDQV

• Full Name: F-box protein 44
• Calculated Molecular Weight: 26 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC007832
• Gene Symbol: FBXO44
• Gene ID (NCBI): 93611
• RRID: AB_3086253
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H4M3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FBXO44 is a member of the F-box protein family that shares a function as substrate recognition factors for the SKP1-CUL1-F-box (SCF)-type ubiquitin ligase. Several human FBXs (FBXO2, FBXO6, FBXO17, FBXO27, and FBXO44) share a conserved G domain (also known as FBA domain), which is responsible for recognizing N-glycan moieties by most FBXs in this group except FBXO44. (PMID: 25970626, PMID: 23086937)