• Featured Product
  • KD/KO Validated

FBXO6 Monoclonal antibody, PBS Only

FBXO6 Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 67697-1-PBS
Clone No.3B7F9

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

3B7F9, F box only protein 6, F box protein 6, FBG2, F-box only protein 6

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67697-1-PBS targets FBXO6 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag30512

Product name: Recombinant human FBXO6 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-293 aa of BC020880

Sequence: MDAPHSKAALDSINELPENILLELFTHVPARQLLLNCRLVCSLWRDLIDLMTLWKRKCLREGFITKDWDQPVADWKIFYFLRSLHRNLLRNPCAEEDMFAWQIDFNGGDRWKVESLPGAHGTDFPDPKVKKYFVTSYEMCLKSQLVDLVAEGYWEELLDTFRPDIVVKDWFAARADCGCTYQLKVQLASADYFVLASFEPPPVTIQQWNNATWTEVSYTFSDYPRGVRYILFQHGGRDTQYWAGWYGPRVTNSSIVVSPKMTRNQASSEAQPGQKHGQEEAAQSPYRAVVQIF

Predict reactive species
Full Name F-box protein 6
Calculated Molecular Weight 293 aa, 34 kDa
Observed Molecular Weight34 kDa
GenBank Accession NumberBC020880
Gene Symbol FBXO6
Gene ID (NCBI) 26270
RRIDAB_2882889
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9NRD1
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

FBXO6(F-box only protein 6 ) is also named as FBG2, FBS2, FBX6 and belongs to the F-box protein family. FBXO6 is the substrate recognition component of a Skp1-Cullin1-F-box protein (SCF) ubiquitin E3 ligase complex, recognizing the chitobiose in unfolded N-glycoprotein to target glycoproteins for polyubiquitination and degradation. It can regulate Chk1 ubiquitination and degradation in both normally cycling cells and during replication stress. This protein is mainly detected in the cytoplasm in both cultured cells and in tumor tissues. Its expression is a predictive biomarker of tumor responsiveness to the important anticancer drugs. Positive Fbxo6 expression correlated with early TNM stage and favorable prognosis of NSCLC patients. (PMID:19716789, PMID: 27855403, PMID: 31140586).

Loading...
||
New chat

Able

正在加载,请稍候...