FBXO7 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• FBXO7 Polyclonal antibody (10696-1-AP)

FBXO7 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 10696-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, CoIP, ELISA

Synonyms

F-box only protein 7, FBX, FBX07, FBX7, FBXO 7

• 

  WB analysis using 10696-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 10696-1-AP (FBXO7 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach using 10696-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 10696-1-AP (FBXO7 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human intrahepatic cholangiocarcinoma using 10696-1-AP

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 10696-1-AP (FBXO7 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human appendicitis using 10696-1-AP

  Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 10696-1-AP (FBXO7 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary cancer using 10696-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 10696-1-AP (FBXO7 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for FBXO7 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells
• Positive IHC detected in: human stomach tissue, human appendicitis tissue, human ovary cancer tissue, human intrahepatic cholangiocarcinoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10696-1-AP targets FBXO7 in WB, IHC, CoIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1035

  Product name: Recombinant human FBXO7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 220-522 aa of BC008361

  Sequence: KALSMPEKWKLSGVYKLQYMHPLCEGSSATLTCVPLGNLIVVNATLKINNEIRSVKRLQLLPESFICKEKLGENVANIYKDLQKLSRLFKDQLVYPLLAFTRQALNLPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDLFTASNDPLLWRFLYLRDFRDNTVRVQDTDWKELYRKRHIQRKESPKGRFVMLLPSSTHTIPFYPNPLHPRPFPSSRLPPGIIGGEYDQRPTLPYVGDPISSLIPGPGETPSQFPPLRPRFDPVGPLPGPNPILPGRGGPNDRFPFRPSRGRPTDGRLSFM

• Full Name: F-box protein 7
• Calculated Molecular Weight: 59 kDa
• Observed Molecular Weight: 59-75 kDa
• GenBank Accession Number: BC008361
• Gene Symbol: FBXO7
• Gene ID (NCBI): 25793
• RRID: AB_2246820
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y3I1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FBXO7, also named as FBX7, is a substrate recognition component of a (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. FBXO7 recognizes BIRC2 and DLGAP5. It function in phosphorylation-dependent ubiquitination.

Publications

What published studies show

The FBXO7 Polyclonal antibody (Cat# 10696-1-AP) has 3 citations. They appear in Hepatology, Cell Death Dis, and JCI Insight. The research fields span hepatocellular carcinoma (HDAC inhibitors and topoisomerase IIα degradation), diabetic kidney disease (tubulointerstitial fibrosis and mitophagy), and neuroprotection (inflammation and PINK1 stabilization).

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,CoIP	Hepatology; Novel mechanism by which histone deacetylase inhibitors facilitate topoisomerase IIα degradation in hepatocellular carcinoma cells.; Authors - Chen Mei-Chuan MC
		Cell Death Dis; Tubular tRF‑1:30‑Gln‑CTG‑4 attenuates tubulointerstitial fibrosis by mitigating FBXO7-mediated mitophagy defect in diabetic kidney disease.; Authors - Jia-ling Ji
human		JCI Insight; Chemical inhibition of FBXO7 reduces inflammation and confers neuroprotection by stabilizing the mitochondrial kinase PINK1.; Authors - Yuan Liu