FBXO7 Polyclonal antibody

• 

  WB analysis using 30458-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30458-1-AP (FBXO7 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

FBXO7 Polyclonal Antibody for WB, ELISA

Cat No. 30458-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

WB, ELISA

Synonyms

DKFZp686B08113, F box only protein 7, F box protein 7, FBX, FBX07, FBX7, FBXO7, PARK15, PKPS

---

Tested Applications

• Positive WB detected in: MCF-7 cells, Raji cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30458-1-AP targets FBXO7 in WB, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32796

  Product name: Recombinant human FBXO7 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 378-522 aa of BC008361

  Sequence: RDFRDNTVRVQDTDWKELYRKRHIQRKESPKGRFVMLLPSSTHTIPFYPNPLHPRPFPSSRLPPGIIGGEYDQRPTLPYVGDPISSLIPGPGETPSQFPPLRPRFDPVGPLPGPNPILPGRGGPNDRFPFRPSRGRPTDGRLSFM

• Full Name: F-box protein 7
• Calculated Molecular Weight: 59 kDa
• Observed Molecular Weight: 59-75 kDa
• GenBank Accession Number: BC008361
• Gene Symbol: FBXO7
• Gene ID (NCBI): 25793
• RRID: AB_3086324
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y3I1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FBXO7, also named as FBX7, is a substrate recognition component of a (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. FBXO7 recognizes BIRC2 and DLGAP5. It function in phosphorylation-dependent ubiquitination.