Tested Applications
| Positive WB detected in | HEK-293 cells, HepG2 cells, MCF-7 cells, mouse brain tissue |
| Positive IP detected in | HEK-293 cells |
| Positive IHC detected in | human lung cancer tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
28424-1-AP targets FBXW7 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag28471 Product name: Recombinant human FBXW7 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-227 aa of NM_001349798 Sequence: MNQELLSVGSKRRRTGGSLRGNPSSSQVDEEQMNRVVEEEQQQQLRQQEEEHTARNGEVVGVEPRPGGQNDSQQGQLEENNNRFISVDEDSSGNQEEQEEDEEHAGEQDEEDEEEEEMDQESDDFDQSDDSSREDEHTHTNSVTNSSSIVDLPVHQLSSPFYTKTTKMKRKLDHGSEVRSFSLGKKPCKVSEYTSTTGLVPCSATPTTFGDLRAANGQGQQRRRITS Predict reactive species |
| Full Name | F-box and WD repeat domain containing 7 |
| Calculated Molecular Weight | 66 kDa |
| Observed Molecular Weight | 100-110 kDa, 66-75 kDa |
| GenBank Accession Number | NM_001349798 |
| Gene Symbol | FBXW7 |
| Gene ID (NCBI) | 55294 |
| RRID | AB_2881138 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q969H0 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
FBXW7, also named as FBW7, FBX30, SEL10 and hAgo, is a substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. It probably recognizes and binds to phosphorylated target proteins. FBXW7 is involved in the degradation of cyclin-E, MYC, NOTCH1 released notch intracellular domain (NICD), and probably PSEN1. FBXW7 is a general tumor suppressor in human cancer (PMID: 17909001). FBXW7 has 3 isoforms (α/β/γ) with the calculated molecular mass of 80 kDa, 70 kDa and 66 kDa, and apparent molecular mass of 100-110 kDa and 66-75 kDa (PMID: 31346036/PMID: 22864569). K48 autoubiquitination is consistent with maintenance of ubiquitinated FBW7 (Ub-FBW7, 200 kDa)(PMID: 32353058).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for FBXW7 antibody 28424-1-AP | Download protocol |
| IP protocol for FBXW7 antibody 28424-1-AP | Download protocol |
| WB protocol for FBXW7 antibody 28424-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
FBXW7 Polyclonal Antibody (Cat# 28424-1-AP) has 56 citations published in journals including Nature Communications, Molecular Cancer, Journal of Experimental & Clinical Cancer Research, Cell Reports, Developmental Cell, EMBO Reports, Journal of Experimental Medicine, Cancer Letters, International Journal of Biological Sciences, Free Radical Biology & Medicine, PLoS Genetics, and Science Reports. Research fields span oncology, ferroptosis, immunotherapy, neurodegeneration, lipid metabolism, stem cell biology, and inflammatory diseases.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther Targeting carnitine palmitoyl transferase 1A (CPT1A) induces ferroptosis and synergizes with immunotherapy in lung cancer | ||
Mol Cancer Loss of FBXW7-mediated degradation of BRAF elicits resistance to BET inhibitors in adult T cell leukemia cells. | ||
Mol Cancer NAP1L1 degradation by FBXW7 reduces the deubiquitination of HDGF-p62 signaling to stimulate autophagy and induce primary cisplatin chemosensitivity in nasopharyngeal carcinoma | ||
Cancer Commun (Lond) PLEK2 promotes cancer stemness and tumorigenesis of head and neck squamous cell carcinoma via the c-Myc-mediated positive feedback loop
| ||
Cell Mol Immunol FBXW7 is a multifaceted regulator of the innate immune response to DNA viruses | ||
Nat Commun Targeting Msx2 as a brake in the fusion fate of osteoclasts and an anabolic therapy in pre-clinical models of osteoporosis |
